Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004890-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SUGP1
Alternative Gene Name: DKFZp434E2216, F23858, RBP, SF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011306: 86%, ENSRNOG00000052111: 83%
Entrez Gene ID: 57794
Uniprot ID: Q8IWZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT |
| Gene Sequence | GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT |
| Gene ID - Mouse | ENSMUSG00000011306 |
| Gene ID - Rat | ENSRNOG00000052111 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) | |
| Datasheet | Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) | |
| Datasheet | Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) |
| Citations for Anti SUGP1 pAb (ATL-HPA004890 w/enhanced validation) – 1 Found |
| Alsafadi, Samar; Dayot, Stephane; Tarin, Malcy; Houy, Alexandre; Bellanger, Dorine; Cornella, Michele; Wassef, Michel; Waterfall, Joshua J; Lehnert, Erik; Roman-Roman, Sergio; Stern, Marc-Henri; Popova, Tatiana. Genetic alterations of SUGP1 mimic mutant-SF3B1 splice pattern in lung adenocarcinoma and other cancers. Oncogene. 2021;40(1):85-96. PubMed |