Anti SUFU pAb (ATL-HPA008700)

Atlas Antibodies

Catalog No.: ATL-HPA008700-100

Protein Description: suppressor of fused homolog (Drosophila)
Gene Name: SUFU
Alternative Gene Name: PRO1280, SUFUH, SUFUXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025231: 97%, ENSRNOG00000019807: 95%
Entrez Gene ID: 51684
Uniprot ID: Q9UMX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTA
• Gene Sequence: TEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTA
• Gene ID - Mouse: ENSMUSG00000025231
• Gene ID - Rat: ENSRNOG00000019807
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SUFU pAb (ATL-HPA008700) – 2 Found

Kenawy, Nihal; Kalirai, Helen; Sacco, Joseph J; Lake, Sarah L; Heegaard, Steffen; Larsen, Ann-Cathrine; Finger, Paul T; Milman, Tatyana; Chin, Kimberly; Mosci, Carlo; Lanza, Francesco; Moulin, Alexandre; Schmitt, Caroline A; Caujolle, Jean Pierre; Maschi, Célia; Marinkovic, Marina; Taktak, Azzam F; Heimann, Heinrich; Damato, Bertil E; Coupland, Sarah E. Conjunctival melanoma copy number alterations and correlation with mutation status, tumor features, and clinical outcome. Pigment Cell & Melanoma Research. 2019;32(4):564-575. 

Rather, Tahseen Bilal; Parveiz, Ishrat; Bhat, Gulzar A; Rashid, Gowhar; Akhtar, Kulsum; Haque, Rizwanul; Ola, Mohammad Shamsul; Ali, Mehboob; Wani, Rauf A; Khan, Ishrat Younas; Besina, Syed; Mudassar, Syed. Colorectal Cancer (CRC): Investigating the Expression of the Suppressor of Fused (SuFu) Gene and Its Relationship with Several Inflammatory Blood-Based Biomarkers. Biomedicines. 2023;11(2)