Anti STXBP2 pAb (ATL-HPA015564)

Atlas Antibodies

Catalog No.: ATL-HPA015564-25

Protein Description: syntaxin binding protein 2
Gene Name: STXBP2
Alternative Gene Name: Hunc18b, UNC18B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004626: 94%, ENSRNOG00000000994: 96%
Entrez Gene ID: 6813
Uniprot ID: Q15833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLN
• Gene Sequence: CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLN
• Gene ID - Mouse: ENSMUSG00000004626
• Gene ID - Rat: ENSRNOG00000000994
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STXBP2 pAb (ATL-HPA015564) – 3 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Sanchez, Elizabeth; Gonzalez, Erika A; Moreno, David S; Cardenas, Rodolfo A; Ramos, Marco A; Davalos, Alfredo J; Manllo, John; Rodarte, Alejandro I; Petrova, Youlia; Moreira, Daniel C; Chavez, Miguel A; Tortoriello, Alejandro; Lara, Adolfo; Gutierrez, Berenice A; Burns, Alan R; Heidelberger, Ruth; Adachi, Roberto. Syntaxin 3, but not syntaxin 4, is required for mast cell-regulated exocytosis, where it plays a primary role mediating compound exocytosis. The Journal Of Biological Chemistry. 2019;294(9):3012-3023. 

Cardenas, Eduardo I; Gonzalez, Ricardo; Breaux, Keegan; Da, Qi; Gutierrez, Berenice A; Ramos, Marco A; Cardenas, Rodolfo A; Burns, Alan R; Rumbaut, Rolando E; Adachi, Roberto. Munc18-2, but not Munc18-1 or Munc18-3, regulates platelet exocytosis, hemostasis, and thrombosis. The Journal Of Biological Chemistry. 2019;294(13):4784-4792.