Anti STX17 pAb (ATL-HPA001204 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001204-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: syntaxin 17
Gene Name: STX17
Alternative Gene Name: FLJ20651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061455: 90%, ENSRNOG00000005801: 86%
Entrez Gene ID: 55014
Uniprot ID: P56962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Gene Sequence RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Gene ID - Mouse ENSMUSG00000061455
Gene ID - Rat ENSRNOG00000005801
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STX17 pAb (ATL-HPA001204 w/enhanced validation)
Datasheet Anti STX17 pAb (ATL-HPA001204 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STX17 pAb (ATL-HPA001204 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti STX17 pAb (ATL-HPA001204 w/enhanced validation)
Datasheet Anti STX17 pAb (ATL-HPA001204 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STX17 pAb (ATL-HPA001204 w/enhanced validation)
Citations for Anti STX17 pAb (ATL-HPA001204 w/enhanced validation) – 48 Found
Zhen, Yuanli; Li, Wei. Impairment of autophagosome-lysosome fusion in the buff mutant mice with the VPS33A(D251E) mutation. Autophagy. 11(9):1608-22.  PubMed
Hubert, Virginie; Peschel, Andrea; Langer, Brigitte; Gröger, Marion; Rees, Andrew; Kain, Renate. LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes. Biology Open. 2016;5(10):1516-1529.  PubMed
Kimura, Tomonori; Jia, Jingyue; Kumar, Suresh; Choi, Seong Won; Gu, Yuexi; Mudd, Michal; Dupont, Nicolas; Jiang, Shanya; Peters, Ryan; Farzam, Farzin; Jain, Ashish; Lidke, Keith A; Adams, Christopher M; Johansen, Terje; Deretic, Vojo. Dedicated SNAREs and specialized TRIM cargo receptors mediate secretory autophagy. The Embo Journal. 2017;36(1):42-60.  PubMed
Jung, Jennifer; Nayak, Arnab; Schaeffer, Véronique; Starzetz, Tatjana; Kirsch, Achim K; Müller, Stefan; Dikic, Ivan; Mittelbronn, Michel; Behrends, Christian. Multiplex image-based autophagy RNAi screening identifies SMCR8 as ULK1 kinase activity and gene expression regulator. Elife. 2017;6( 28195531)  PubMed
Uematsu, Masaaki; Nishimura, Taki; Sakamaki, Yuriko; Yamamoto, Hayashi; Mizushima, Noboru. Accumulation of undegraded autophagosomes by expression of dominant-negative STX17 (syntaxin 17) mutants. Autophagy. 2017;13(8):1452-1464.  PubMed
Jung, Jennifer; Behrends, Christian. Protocol for Establishing a Multiplex Image-based Autophagy RNAi Screen in Cell Cultures. Bio-Protocol. 2017;7(17):27982478.  PubMed
Kumar, Suresh; Jain, Ashish; Farzam, Farzin; Jia, Jingyue; Gu, Yuexi; Choi, Seong Won; Mudd, Michal H; Claude-Taupin, Aurore; Wester, Michael J; Lidke, Keith A; Rusten, Tor-Erik; Deretic, Vojo. Mechanism of Stx17 recruitment to autophagosomes via IRGM and mammalian Atg8 proteins. The Journal Of Cell Biology. 2018;217(3):997-1013.  PubMed
Kimura, Hana; Arasaki, Kohei; Ohsaki, Yuki; Fujimoto, Toyoshi; Ohtomo, Takayuki; Yamada, Junji; Tagaya, Mitsuo. Syntaxin 17 promotes lipid droplet formation by regulating the distribution of acyl-CoA synthetase 3. Journal Of Lipid Research. 2018;59(5):805-819.  PubMed
Hua, Rongrong; Han, Song; Zhang, Nan; Dai, Qingqing; Liu, Ting; Li, Junfa. cPKCγ-Modulated Sequential Reactivation of mTOR Inhibited Autophagic Flux in Neurons Exposed to Oxygen Glucose Deprivation/Reperfusion. International Journal Of Molecular Sciences. 2018;19(5)  PubMed
Matsui, Takahide; Jiang, Peidu; Nakano, Saori; Sakamaki, Yuriko; Yamamoto, Hayashi; Mizushima, Noboru. Autophagosomal YKT6 is required for fusion with lysosomes independently of syntaxin 17. The Journal Of Cell Biology. 2018;217(8):2633-2645.  PubMed
Wang, Chenyao; Wang, Huafei; Zhang, Deyi; Luo, Wenwen; Liu, Ruilong; Xu, Daqian; Diao, Lei; Liao, Lujian; Liu, Zhixue. Phosphorylation of ULK1 affects autophagosome fusion and links chaperone-mediated autophagy to macroautophagy. Nature Communications. 2018;9(1):3492.  PubMed
Saito, Toshiro; Nah, Jihoon; Oka, Shin-Ichi; Mukai, Risa; Monden, Yoshiya; Maejima, Yasuhiro; Ikeda, Yoshiyuki; Sciarretta, Sebastiano; Liu, Tong; Li, Hong; Baljinnyam, Erdene; Fraidenraich, Diego; Fritzky, Luke; Zhai, Peiyong; Ichinose, Shizuko; Isobe, Mitsuaki; Hsu, Chiao-Po; Kundu, Mondira; Sadoshima, Junichi. An alternative mitophagy pathway mediated by Rab9 protects the heart against ischemia. The Journal Of Clinical Investigation. 2019;129(2):802-819.  PubMed
Yang, Huan; Shen, Hongtao; Li, Jing; Guo, Lian-Wang. SIGMAR1/Sigma-1 receptor ablation impairs autophagosome clearance. Autophagy. 2019;15(9):1539-1557.  PubMed
Xian, Hongxu; Yang, Qiaoyun; Xiao, Lin; Shen, Han-Ming; Liou, Yih-Cherng. STX17 dynamically regulated by Fis1 induces mitophagy via hierarchical macroautophagic mechanism. Nature Communications. 2019;10(1):2059.  PubMed
Shen, Qiuhong; Shi, Yin; Liu, Jiaqi; Su, Hua; Huang, Jingtao; Zhang, Yi; Peng, Chao; Zhou, Tianhua; Sun, Qiming; Wan, Wei; Liu, Wei. Acetylation of STX17 (syntaxin 17) controls autophagosome maturation. Autophagy. 2021;17(5):1157-1169.  PubMed
Li, Ruolin; Lu, Yongquan; Zhang, Qidi; Liu, Weijin; Yang, Runing; Jiao, Jie; Liu, Jia; Gao, Ge; Yang, Hui. Piperine promotes autophagy flux by P2RX4 activation in SNCA/α-synuclein-induced Parkinson disease model. Autophagy. 2022;18(3):559-575.  PubMed
An, Zhiyuan; Ding, Wenyi. Acinetobacter baumannii up-regulates LncRNA-GAS5 and promotes the degradation of STX17 by blocking the activation of YY1. Virulence. 2021;12(1):1965-1979.  PubMed
Li, Ting; Lu, Dingyi; Yao, Chengcheng; Li, Tingting; Dong, Hua; Li, Zhan; Xu, Guang; Chen, Jiayi; Zhang, Hao; Yi, Xiaoyu; Zhu, Haizhen; Liu, Guangqin; Wen, Kaiqing; Zhao, Haixin; Gao, Jun; Zhang, Yakun; Han, Qiuying; Li, Teng; Zhang, Weina; Zhao, Jie; Li, Tao; Bai, Zhaofang; Song, Moshi; He, Xinhua; Zhou, Tao; Xia, Qing; Li, Ailing; Pan, Xin. Kansl1 haploinsufficiency impairs autophagosome-lysosome fusion and links autophagic dysfunction with Koolen-de Vries syndrome in mice. Nature Communications. 2022;13(1):931.  PubMed
Jiang, Peidu; Nishimura, Taki; Sakamaki, Yuriko; Itakura, Eisuke; Hatta, Tomohisa; Natsume, Tohru; Mizushima, Noboru. The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17. Molecular Biology Of The Cell. 2014;25(8):1327-37.  PubMed
Diao, Jiajie; Liu, Rong; Rong, Yueguang; Zhao, Minglei; Zhang, Jing; Lai, Ying; Zhou, Qiangjun; Wilz, Livia M; Li, Jianxu; Vivona, Sandro; Pfuetzner, Richard A; Brunger, Axel T; Zhong, Qing. ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes. Nature. 2015;520(7548):563-6.  PubMed
Ren, Huimei; Elgner, Fabian; Jiang, Bingfu; Himmelsbach, Kiyoshi; Medvedev, Regina; Ploen, Daniela; Hildt, Eberhard. The Autophagosomal SNARE Protein Syntaxin 17 Is an Essential Factor for the Hepatitis C Virus Life Cycle. Journal Of Virology. 2016;90(13):5989-6000.  PubMed
McLelland, Gian-Luca; Lee, Sydney A; McBride, Heidi M; Fon, Edward A. Syntaxin-17 delivers PINK1/parkin-dependent mitochondrial vesicles to the endolysosomal system. The Journal Of Cell Biology. 2016;214(3):275-91.  PubMed
Beckerman, Pazit; Bi-Karchin, Jing; Park, Ae Seo Deok; Qiu, Chengxiang; Dummer, Patrick D; Soomro, Irfana; Boustany-Kari, Carine M; Pullen, Steven S; Miner, Jeffrey H; Hu, Chien-An A; Rohacs, Tibor; Inoue, Kazunori; Ishibe, Shuta; Saleem, Moin A; Palmer, Matthew B; Cuervo, Ana Maria; Kopp, Jeffrey B; Susztak, Katalin. Transgenic expression of human APOL1 risk variants in podocytes induces kidney disease in mice. Nature Medicine. 2017;23(4):429-438.  PubMed
Fu, Ruoqiu; Deng, Qin; Zhang, Hongwei; Hu, Xiaoye; Li, Yunong; Liu, Yanxia; Hu, Jinjiao; Luo, Qingsong; Zhang, Yanhao; Jiang, Xiuxing; Li, Lirong; Yang, Chong; Gao, Ning. A novel autophagy inhibitor berbamine blocks SNARE-mediated autophagosome-lysosome fusion through upregulation of BNIP3. Cell Death & Disease. 2018;9(2):243.  PubMed
Barbero-Camps, Elisabet; Roca-Agujetas, Vicente; Bartolessis, Isabel; de Dios, Cristina; Fernández-Checa, Jose C; Marí, Montserrat; Morales, Albert; Hartmann, Tobias; Colell, Anna. Cholesterol impairs autophagy-mediated clearance of amyloid beta while promoting its secretion. Autophagy. 14(7):1129-1154.  PubMed
Wu, Man; Lao, Yuan-Zhi; Tan, Hong-Sheng; Lu, Guang; Ren, Yi; Zheng, Zhao-Qing; Yi, Juan; Fu, Wen-Wei; Shen, Han-Ming; Xu, Hong-Xi. Oblongifolin C suppresses lysosomal function independently of TFEB nuclear translocation. Acta Pharmacologica Sinica. 2019;40(7):929-937.  PubMed
Xia, Yu; Liu, Na; Xie, Xiuxiu; Bi, Guoyu; Ba, Hongping; Li, Lin; Zhang, Jinxia; Deng, Xiaofei; Yao, Yao; Tang, Zhaohui; Yin, Binjiao; Wang, Jing; Jiang, Kan; Li, Zhuoya; Choi, Yongwon; Gong, Feili; Cheng, Xiang; O'Shea, John J; Chae, Jae Jin; Laurence, Arian; Yang, Xiang-Ping. The macrophage-specific V-ATPase subunit ATP6V0D2 restricts inflammasome activation and bacterial infection by facilitating autophagosome-lysosome fusion. Autophagy. 2019;15(6):960-975.  PubMed
Kumar, Suresh; Gu, Yuexi; Abudu, Yakubu Princely; Bruun, Jack-Ansgar; Jain, Ashish; Farzam, Farzin; Mudd, Michal; Anonsen, Jan Haug; Rusten, Tor Erik; Kasof, Gary; Ktistakis, Nicholas; Lidke, Keith A; Johansen, Terje; Deretic, Vojo. Phosphorylation of Syntaxin 17 by TBK1 Controls Autophagy Initiation. Developmental Cell. 2019;49(1):130-144.e6.  PubMed
Turco, Eleonora; Witt, Marie; Abert, Christine; Bock-Bierbaum, Tobias; Su, Ming-Yuan; Trapannone, Riccardo; Sztacho, Martin; Danieli, Alberto; Shi, Xiaoshan; Zaffagnini, Gabriele; Gamper, Annamaria; Schuschnig, Martina; Fracchiolla, Dorotea; Bernklau, Daniel; Romanov, Julia; Hartl, Markus; Hurley, James H; Daumke, Oliver; Martens, Sascha. FIP200 Claw Domain Binding to p62 Promotes Autophagosome Formation at Ubiquitin Condensates. Molecular Cell. 2019;74(2):330-346.e11.  PubMed
Vats, Somya; Manjithaya, Ravi. A reversible autophagy inhibitor blocks autophagosome-lysosome fusion by preventing Stx17 loading onto autophagosomes. Molecular Biology Of The Cell. 2019;30(17):2283-2295.  PubMed
Tian, Xiaoyu; Zheng, Pengli; Zhou, Chenqian; Wang, Xurui; Ma, Hua; Ma, Wei; Zhou, Xiaokai; Teng, Junlin; Chen, Jianguo. DIPK2A promotes STX17- and VAMP7-mediated autophagosome-lysosome fusion by binding to VAMP7B. Autophagy. 2020;16(5):797-810.  PubMed
Gao, Guang; Zhu, Chengjia; Liu, Emma; Nabi, Ivan R. Reticulon and CLIMP-63 regulate nanodomain organization of peripheral ER tubules. Plos Biology. 2019;17(8):e3000355.  PubMed
Gu, Yuexi; Princely Abudu, Yakubu; Kumar, Suresh; Bissa, Bhawana; Choi, Seong Won; Jia, Jingyue; Lazarou, Michael; Eskelinen, Eeva-Liisa; Johansen, Terje; Deretic, Vojo. Mammalian Atg8 proteins regulate lysosome and autolysosome biogenesis through SNAREs. The Embo Journal. 2019;38(22):e101994.  PubMed
Wang, Binran; Xiao, Xiaoyue; Huang, Fanwei; Liu, Rong. Syntaxin-17-Dependent Mitochondrial Dynamics is Essential for Protection Against Oxidative-Stress-Induced Apoptosis. Antioxidants (Basel, Switzerland). 2019;8(11)  PubMed
Wernersson, Anya; Sarmiento, Luis; Cowan, Elaine; Fex, Malin; Cilio, Corrado M. Human enteroviral infection impairs autophagy in clonal INS(832/13) cells and human pancreatic islet cells. Diabetologia. 2020;63(11):2372-2384.  PubMed
Kumar, Suresh; Jain, Ashish; Choi, Seong Won; da Silva, Gustavo Peixoto Duarte; Allers, Lee; Mudd, Michal H; Peters, Ryan Scott; Anonsen, Jan Haug; Rusten, Tor-Erik; Lazarou, Michael; Deretic, Vojo. Mammalian Atg8 proteins and the autophagy factor IRGM control mTOR and TFEB at a regulatory node critical for responses to pathogens. Nature Cell Biology. 2020;22(8):973-985.  PubMed
Fraiberg, Milana; Tamim-Yecheskel, Bat-Chen; Kokabi, Kamilya; Subic, Nemanja; Heimer, Gali; Eck, Franziska; Nalbach, Karsten; Behrends, Christian; Ben-Zeev, Bruria; Shatz, Oren; Elazar, Zvulun. Lysosomal targeting of autophagosomes by the TECPR domain of TECPR2. Autophagy. 2021;17(10):3096-3108.  PubMed
Cantarero, Lara; Juárez-Escoto, Elena; Civera-Tregón, Azahara; Rodríguez-Sanz, María; Roldán, Mónica; Benítez, Raúl; Hoenicka, Janet; Palau, Francesc. Mitochondria-lysosome membrane contacts are defective in GDAP1-related Charcot-Marie-Tooth disease. Human Molecular Genetics. 2021;29(22):3589-3605.  PubMed
Dolai, Subhankar; Takahashi, Toshimasa; Qin, Tairan; Liang, Tao; Xie, Li; Kang, Fei; Miao, Yi-Fan; Xie, Huanli; Kang, Youhou; Manuel, Justin; Winter, Erin; Roche, Paul A; Cattral, Mark S; Gaisano, Herbert Y. Pancreas-specific SNAP23 depletion prevents pancreatitis by attenuating pathological basolateral exocytosis and formation of trypsin-activating autolysosomes. Autophagy. 2021;17(10):3068-3081.  PubMed
Moriggi, Manuela; Capitanio, Daniele; Torretta, Enrica; Barbacini, Pietro; Bragato, Cinzia; Sartori, Patrizia; Moggio, Maurizio; Maggi, Lorenzo; Mora, Marina; Gelfi, Cecilia. Muscle Proteomic Profile before and after Enzyme Replacement Therapy in Late-Onset Pompe Disease. International Journal Of Molecular Sciences. 2021;22(6)  PubMed
Xu, Yinfeng; Wu, Yaosen; Wang, Lei; Ren, Zhuo; Song, Lijiang; Zhang, Hui; Qian, Chuying; Wang, Qian; He, Zhengfu; Wan, Wei. Autophagy deficiency activates rDNA transcription. Autophagy. 2022;18(6):1338-1349.  PubMed
Buchacher, Tanja; Honkimaa, Anni; Välikangas, Tommi; Lietzén, Niina; Hirvonen, M Karoliina; Laiho, Jutta E; Sioofy-Khojine, Amir-Babak; Eskelinen, Eeva-Liisa; Hyöty, Heikki; Elo, Laura L; Lahesmaa, Riitta. Persistent coxsackievirus B1 infection triggers extensive changes in the transcriptome of human pancreatic ductal cells. Iscience. 2022;25(1):103653.  PubMed
Carter, Rachel J; Milani, Mateus; Beckett, Alison J; Liu, Shiyu; Prior, Ian A; Cohen, Gerald M; Varadarajan, Shankar. Novel roles of RTN4 and CLIMP-63 in regulating mitochondrial structure, bioenergetics and apoptosis. Cell Death & Disease. 2022;13(5):436.  PubMed
Oe, Yukako; Kakuda, Keita; Yoshimura, Shin-Ichiro; Hara, Naohiro; Hasegawa, Junya; Terawaki, Seigo; Kimura, Yasuyoshi; Ikenaka, Kensuke; Suetsugu, Shiro; Mochizuki, Hideki; Yoshimori, Tamotsu; Nakamura, Shuhei. PACSIN1 is indispensable for amphisome-lysosome fusion during basal autophagy and subsets of selective autophagy. Plos Genetics. 2022;18(6):e1010264.  PubMed
He, Yi; Yi, Xin; Zhang, Zihao; Luo, Hanshen; Li, Rui; Feng, Xin; Fang, Ze-Min; Zhu, Xue-Hai; Cheng, Wenlin; Jiang, Ding-Sheng; Zhao, Fang; Wei, Xiang. JIB-04, a histone demethylase Jumonji C domain inhibitor, regulates phenotypic switching of vascular smooth muscle cells. Clinical Epigenetics. 2022;14(1):101.  PubMed
Kumar, Suresh; Javed, Ruheena; Mudd, Michal; Pallikkuth, Sandeep; Lidke, Keith A; Jain, Ashish; Tangavelou, Karthikeyan; Gudmundsson, Sigurdur Runar; Ye, Chunyan; Rusten, Tor Erik; Anonsen, Jan Haug; Lystad, Alf Håkon; Claude-Taupin, Aurore; Simonsen, Anne; Salemi, Michelle; Phinney, Brett; Li, Jing; Guo, Lian-Wang; Bradfute, Steven B; Timmins, Graham S; Eskelinen, Eeva-Liisa; Deretic, Vojo. Mammalian hybrid pre-autophagosomal structure HyPAS generates autophagosomes. Cell. 2021;184(24):5950-5969.e22.  PubMed
Shi, Yingxin; Yan, Sheng; Shao, Guang-Can; Wang, Jinglong; Jian, Yong-Ping; Liu, Bo; Yuan, Yanqiu; Qin, Ke; Nai, Shanshan; Huang, Xiahe; Wang, Yingchun; Chen, Zhenghui; Chen, Xing; Dong, Meng-Qiu; Geng, Yiqun; Xu, Zhi-Xiang; Li, Jing. O-GlcNAcylation stabilizes the autophagy-initiating kinase ULK1 by inhibiting chaperone-mediated autophagy upon HPV infection. The Journal Of Biological Chemistry. 2022;298(9):102341.  PubMed
Herrera-Cruz, Maria Sol; Yap, Megan C; Tahbaz, Nasser; Phillips, Keelie; Thomas, Laurel; Thomas, Gary; Simmen, Thomas. Rab32 uses its effector reticulon 3L to trigger autophagic degradation of mitochondria-associated membrane (MAM) proteins. Biology Direct. 2021;16(1):22.  PubMed