Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043531-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Gene Name: STUB1
Alternative Gene Name: CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039615: 100%, ENSRNOG00000019798: 100%
Entrez Gene ID: 10273
Uniprot ID: Q9UNE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ
Gene Sequence LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ
Gene ID - Mouse ENSMUSG00000039615
Gene ID - Rat ENSRNOG00000019798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation)
Datasheet Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation)
Datasheet Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation)
Citations for Anti STUB1 pAb (ATL-HPA043531 w/enhanced validation) – 1 Found
Shi, Chang-He; Rubel, Carrie; Soss, Sarah E; Sanchez-Hodge, Rebekah; Zhang, Shuo; Madrigal, Sabrina C; Ravi, Saranya; McDonough, Holly; Page, Richard C; Chazin, Walter J; Patterson, Cam; Mao, Cheng-Yuan; Willis, Monte S; Luo, Hai-Yang; Li, Yu-Sheng; Stevens, Donte A; Tang, Mi-Bo; Du, Pan; Wang, Yao-He; Hu, Zheng-Wei; Xu, Yu-Ming; Schisler, Jonathan C. Disrupted structure and aberrant function of CHIP mediates the loss of motor and cognitive function in preclinical models of SCAR16. Plos Genetics. 2018;14(9):e1007664.  PubMed