Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041222-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Gene Name: STUB1
Alternative Gene Name: CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039615: 100%, ENSRNOG00000019798: 100%
Entrez Gene ID: 10273
Uniprot ID: Q9UNE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Gene Sequence CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Gene ID - Mouse ENSMUSG00000039615
Gene ID - Rat ENSRNOG00000019798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation)
Datasheet Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation)
Datasheet Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation)
Citations for Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed