Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041222-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/91355/166547/atl-hpa041222_anti-stub1-pab-atl-hpa041222-wenhanced-validation_48191__25208.1681119409.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: STUB1
Alternative Gene Name: CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039615: 100%, ENSRNOG00000019798: 100%
Entrez Gene ID: 10273
Uniprot ID: Q9UNE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY |
| Gene Sequence | CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY |
| Gene ID - Mouse | ENSMUSG00000039615 |
| Gene ID - Rat | ENSRNOG00000019798 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) | |
| Datasheet | Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) | |
| Datasheet | Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) |
| Citations for Anti STUB1 pAb (ATL-HPA041222 w/enhanced validation) – 1 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |