Anti STT3B pAb (ATL-HPA036448)

Atlas Antibodies

Catalog No.: ATL-HPA036448-25

Protein Description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Gene Name: STT3B
Alternative Gene Name: FLJ90106, SIMP, STT3-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032437: 92%, ENSRNOG00000011922: 95%
Entrez Gene ID: 201595
Uniprot ID: Q8TCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
• Gene Sequence: KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
• Gene ID - Mouse: ENSMUSG00000032437
• Gene ID - Rat: ENSRNOG00000011922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.