Anti STT3B pAb (ATL-HPA036448)

Atlas Antibodies

Catalog No.:
ATL-HPA036448-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Gene Name: STT3B
Alternative Gene Name: FLJ90106, SIMP, STT3-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032437: 92%, ENSRNOG00000011922: 95%
Entrez Gene ID: 201595
Uniprot ID: Q8TCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Gene Sequence KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Gene ID - Mouse ENSMUSG00000032437
Gene ID - Rat ENSRNOG00000011922
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STT3B pAb (ATL-HPA036448)
Datasheet Anti STT3B pAb (ATL-HPA036448) Datasheet (External Link)
Vendor Page Anti STT3B pAb (ATL-HPA036448) at Atlas Antibodies

Documents & Links for Anti STT3B pAb (ATL-HPA036448)
Datasheet Anti STT3B pAb (ATL-HPA036448) Datasheet (External Link)
Vendor Page Anti STT3B pAb (ATL-HPA036448)