Anti STT3A pAb (ATL-HPA030735)

Atlas Antibodies

Catalog No.: ATL-HPA030735-25

Protein Description: STT3A, subunit of the oligosaccharyltransferase complex (catalytic)
Gene Name: STT3A
Alternative Gene Name: ITM1, MGC9042, STT3-A, TMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032116: 96%, ENSRNOG00000031896: 96%
Entrez Gene ID: 3703
Uniprot ID: P46977
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
• Gene Sequence: VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
• Gene ID - Mouse: ENSMUSG00000032116
• Gene ID - Rat: ENSRNOG00000031896
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STT3A pAb (ATL-HPA030735) – 2 Found

Casas-Sanchez, Aitor; Romero-Ramirez, Alessandra; Hargreaves, Eleanor; Ellis, Cameron C; Grajeda, Brian I; Estevao, Igor L; Patterson, Edward I; Hughes, Grant L; Almeida, Igor C; Zech, Tobias; Acosta-Serrano, Álvaro. Inhibition of Protein N-Glycosylation Blocks SARS-CoV-2 Infection. Mbio. 2021;13(1):e0371821. 

Zhu, Shenglin; Wan, Weiwei; Zhang, Yanjun; Shang, Weijuan; Pan, Xiaoyan; Zhang, Lei-Ke; Xiao, Gengfu. Comprehensive Interactome Analysis Reveals that STT3B Is Required for N-Glycosylation of Lassa Virus Glycoprotein. Journal Of Virology. 2019;93(23)