Anti STRAP pAb (ATL-HPA027320)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027320-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: STRAP
Alternative Gene Name: MAWD, pt-wd, UNRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030224: 100%, ENSRNOG00000048985: 100%
Entrez Gene ID: 11171
Uniprot ID: Q9Y3F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTL |
| Gene Sequence | AFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTL |
| Gene ID - Mouse | ENSMUSG00000030224 |
| Gene ID - Rat | ENSRNOG00000048985 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STRAP pAb (ATL-HPA027320) | |
| Datasheet | Anti STRAP pAb (ATL-HPA027320) Datasheet (External Link) |
| Vendor Page | Anti STRAP pAb (ATL-HPA027320) at Atlas Antibodies |
| Documents & Links for Anti STRAP pAb (ATL-HPA027320) | |
| Datasheet | Anti STRAP pAb (ATL-HPA027320) Datasheet (External Link) |
| Vendor Page | Anti STRAP pAb (ATL-HPA027320) |