Anti STRAP pAb (ATL-HPA027320)

Atlas Antibodies

Catalog No.: ATL-HPA027320-25

Protein Description: serine/threonine kinase receptor associated protein
Gene Name: STRAP
Alternative Gene Name: MAWD, pt-wd, UNRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030224: 100%, ENSRNOG00000048985: 100%
Entrez Gene ID: 11171
Uniprot ID: Q9Y3F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTL
• Gene Sequence: AFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTL
• Gene ID - Mouse: ENSMUSG00000030224
• Gene ID - Rat: ENSRNOG00000048985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.