Anti STOX1 pAb (ATL-HPA037845)

Atlas Antibodies

Catalog No.:
ATL-HPA037845-25
Immunohistochemical staining of human fallopian tube shows nuclear and cytoplasmic positivity in glandular cells.
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
ChIP-Exo-Seq composite graph for Anti-STOX1 (HPA037845, Lot 000006890) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: storkhead box 1
Gene Name: STOX1
Alternative Gene Name: C10orf24, FLJ25162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036923: 55%, ENSRNOG00000023712: 53%
Entrez Gene ID: 219736
Uniprot ID: Q6ZVD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEK
Gene Sequence SEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEK
Gene ID - Mouse ENSMUSG00000036923
Gene ID - Rat ENSRNOG00000023712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STOX1 pAb (ATL-HPA037845)
Datasheet Anti STOX1 pAb (ATL-HPA037845) Datasheet (External Link)
Vendor Page Anti STOX1 pAb (ATL-HPA037845) at Atlas Antibodies

Documents & Links for Anti STOX1 pAb (ATL-HPA037845)
Datasheet Anti STOX1 pAb (ATL-HPA037845) Datasheet (External Link)
Vendor Page Anti STOX1 pAb (ATL-HPA037845)
Citations for Anti STOX1 pAb (ATL-HPA037845) – 1 Found
Chatre, Laurent; Ducat, Aurélien; Spradley, Frank T; Palei, Ana C; Chéreau, Christiane; Couderc, Betty; Thomas, Kamryn C; Wilson, Anna R; Amaral, Lorena M; Gaillard, Irène; Méhats, Céline; Lagoutte, Isabelle; Jacques, Sébastien; Miralles, Francisco; Batteux, Frédéric; Granger, Joey P; Ricchetti, Miria; Vaiman, Daniel. Increased NOS coupling by the metabolite tetrahydrobiopterin (BH4) reduces preeclampsia/IUGR consequences. Redox Biology. 2022;55( 35964341):102406.  PubMed
!