Anti STOX1 pAb (ATL-HPA037844)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037844-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: STOX1
Alternative Gene Name: C10orf24, FLJ25162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036923: 47%, ENSRNOG00000023712: 43%
Entrez Gene ID: 219736
Uniprot ID: Q6ZVD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DESRLMPASMTYLVSMESCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQNGAVSVSAEHH |
| Gene Sequence | DESRLMPASMTYLVSMESCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQNGAVSVSAEHH |
| Gene ID - Mouse | ENSMUSG00000036923 |
| Gene ID - Rat | ENSRNOG00000023712 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STOX1 pAb (ATL-HPA037844) | |
| Datasheet | Anti STOX1 pAb (ATL-HPA037844) Datasheet (External Link) |
| Vendor Page | Anti STOX1 pAb (ATL-HPA037844) at Atlas Antibodies |
| Documents & Links for Anti STOX1 pAb (ATL-HPA037844) | |
| Datasheet | Anti STOX1 pAb (ATL-HPA037844) Datasheet (External Link) |
| Vendor Page | Anti STOX1 pAb (ATL-HPA037844) |