Anti STOX1 pAb (ATL-HPA037844)

Atlas Antibodies

Catalog No.:
ATL-HPA037844-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: storkhead box 1
Gene Name: STOX1
Alternative Gene Name: C10orf24, FLJ25162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036923: 47%, ENSRNOG00000023712: 43%
Entrez Gene ID: 219736
Uniprot ID: Q6ZVD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DESRLMPASMTYLVSMESCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQNGAVSVSAEHH
Gene Sequence DESRLMPASMTYLVSMESCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQNGAVSVSAEHH
Gene ID - Mouse ENSMUSG00000036923
Gene ID - Rat ENSRNOG00000023712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STOX1 pAb (ATL-HPA037844)
Datasheet Anti STOX1 pAb (ATL-HPA037844) Datasheet (External Link)
Vendor Page Anti STOX1 pAb (ATL-HPA037844) at Atlas Antibodies

Documents & Links for Anti STOX1 pAb (ATL-HPA037844)
Datasheet Anti STOX1 pAb (ATL-HPA037844) Datasheet (External Link)
Vendor Page Anti STOX1 pAb (ATL-HPA037844)