Anti STK17A pAb (ATL-HPA037979)

Atlas Antibodies

Catalog No.:
ATL-HPA037979-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 17a
Gene Name: STK17A
Alternative Gene Name: DRAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093996: 33%, ENSRNOG00000012502: 35%
Entrez Gene ID: 9263
Uniprot ID: Q9UEE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTE
Gene Sequence RTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTE
Gene ID - Mouse ENSMUSG00000093996
Gene ID - Rat ENSRNOG00000012502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK17A pAb (ATL-HPA037979)
Datasheet Anti STK17A pAb (ATL-HPA037979) Datasheet (External Link)
Vendor Page Anti STK17A pAb (ATL-HPA037979) at Atlas Antibodies

Documents & Links for Anti STK17A pAb (ATL-HPA037979)
Datasheet Anti STK17A pAb (ATL-HPA037979) Datasheet (External Link)
Vendor Page Anti STK17A pAb (ATL-HPA037979)