Anti STK17A pAb (ATL-HPA018138)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018138-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: STK17A
Alternative Gene Name: DRAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026094: 33%, ENSRNOG00000012502: 33%
Entrez Gene ID: 9263
Uniprot ID: Q9UEE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE |
| Gene Sequence | NISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE |
| Gene ID - Mouse | ENSMUSG00000026094 |
| Gene ID - Rat | ENSRNOG00000012502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STK17A pAb (ATL-HPA018138) | |
| Datasheet | Anti STK17A pAb (ATL-HPA018138) Datasheet (External Link) |
| Vendor Page | Anti STK17A pAb (ATL-HPA018138) at Atlas Antibodies |
| Documents & Links for Anti STK17A pAb (ATL-HPA018138) | |
| Datasheet | Anti STK17A pAb (ATL-HPA018138) Datasheet (External Link) |
| Vendor Page | Anti STK17A pAb (ATL-HPA018138) |