Anti STEAP4 pAb (ATL-HPA075871)

Atlas Antibodies

Catalog No.:
ATL-HPA075871-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: STEAP family member 4
Gene Name: STEAP4
Alternative Gene Name: FLJ23153, STAMP2, TIARP, TNFAIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012428: 65%, ENSRNOG00000008602: 71%
Entrez Gene ID: 79689
Uniprot ID: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD
Gene Sequence IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD
Gene ID - Mouse ENSMUSG00000012428
Gene ID - Rat ENSRNOG00000008602
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STEAP4 pAb (ATL-HPA075871)
Datasheet Anti STEAP4 pAb (ATL-HPA075871) Datasheet (External Link)
Vendor Page Anti STEAP4 pAb (ATL-HPA075871) at Atlas Antibodies

Documents & Links for Anti STEAP4 pAb (ATL-HPA075871)
Datasheet Anti STEAP4 pAb (ATL-HPA075871) Datasheet (External Link)
Vendor Page Anti STEAP4 pAb (ATL-HPA075871)