Anti STEAP4 pAb (ATL-HPA075871)

Atlas Antibodies

Catalog No.: ATL-HPA075871-25

Protein Description: STEAP family member 4
Gene Name: STEAP4
Alternative Gene Name: FLJ23153, STAMP2, TIARP, TNFAIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012428: 65%, ENSRNOG00000008602: 71%
Entrez Gene ID: 79689
Uniprot ID: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD
• Gene Sequence: IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD
• Gene ID - Mouse: ENSMUSG00000012428
• Gene ID - Rat: ENSRNOG00000008602
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.