Anti STAU2 pAb (ATL-HPA019155)

Atlas Antibodies

Catalog No.:
ATL-HPA019155-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: staufen double-stranded RNA binding protein 2
Gene Name: STAU2
Alternative Gene Name: 39K2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025920: 99%, ENSRNOG00000042458: 56%
Entrez Gene ID: 27067
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
Gene Sequence LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
Gene ID - Mouse ENSMUSG00000025920
Gene ID - Rat ENSRNOG00000042458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STAU2 pAb (ATL-HPA019155)
Datasheet Anti STAU2 pAb (ATL-HPA019155) Datasheet (External Link)
Vendor Page Anti STAU2 pAb (ATL-HPA019155) at Atlas Antibodies

Documents & Links for Anti STAU2 pAb (ATL-HPA019155)
Datasheet Anti STAU2 pAb (ATL-HPA019155) Datasheet (External Link)
Vendor Page Anti STAU2 pAb (ATL-HPA019155)
Citations for Anti STAU2 pAb (ATL-HPA019155) – 2 Found
Gleghorn, Michael L; Gong, Chenguang; Kielkopf, Clara L; Maquat, Lynne E. Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay. Nature Structural & Molecular Biology. 2013;20(4):515-24.  PubMed
Condé, Lionel; Gonzalez Quesada, Yulemi; Bonnet-Magnaval, Florence; Beaujois, Rémy; DesGroseillers, Luc. STAU2 protein level is controlled by caspases and the CHK1 pathway and regulates cell cycle progression in the non-transformed hTERT-RPE1 cells. Bmc Molecular And Cell Biology. 2021;22(1):16.  PubMed