Anti STAU2 pAb (ATL-HPA019155)

Atlas Antibodies

Catalog No.: ATL-HPA019155-25

Protein Description: staufen double-stranded RNA binding protein 2
Gene Name: STAU2
Alternative Gene Name: 39K2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025920: 99%, ENSRNOG00000042458: 56%
Entrez Gene ID: 27067
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
• Gene Sequence: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
• Gene ID - Mouse: ENSMUSG00000025920
• Gene ID - Rat: ENSRNOG00000042458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STAU2 pAb (ATL-HPA019155) – 2 Found

Gleghorn, Michael L; Gong, Chenguang; Kielkopf, Clara L; Maquat, Lynne E. Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay. Nature Structural & Molecular Biology. 2013;20(4):515-24. 

Condé, Lionel; Gonzalez Quesada, Yulemi; Bonnet-Magnaval, Florence; Beaujois, Rémy; DesGroseillers, Luc. STAU2 protein level is controlled by caspases and the CHK1 pathway and regulates cell cycle progression in the non-transformed hTERT-RPE1 cells. Bmc Molecular And Cell Biology. 2021;22(1):16.