Anti STAT5A pAb (ATL-HPA027873)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027873-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: STAT5A
Alternative Gene Name: MGF, STAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004043: 91%, ENSRNOG00000019496: 93%
Entrez Gene ID: 6776
Uniprot ID: P42229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS |
| Gene Sequence | YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS |
| Gene ID - Mouse | ENSMUSG00000004043 |
| Gene ID - Rat | ENSRNOG00000019496 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STAT5A pAb (ATL-HPA027873) | |
| Datasheet | Anti STAT5A pAb (ATL-HPA027873) Datasheet (External Link) |
| Vendor Page | Anti STAT5A pAb (ATL-HPA027873) at Atlas Antibodies |
| Documents & Links for Anti STAT5A pAb (ATL-HPA027873) | |
| Datasheet | Anti STAT5A pAb (ATL-HPA027873) Datasheet (External Link) |
| Vendor Page | Anti STAT5A pAb (ATL-HPA027873) |