Anti ST8SIA5 pAb (ATL-HPA046771)

Atlas Antibodies

Catalog No.: ATL-HPA046771-25

Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5
Gene Name: ST8SIA5
Alternative Gene Name: SIAT8E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025425: 85%, ENSRNOG00000022691: 85%
Entrez Gene ID: 29906
Uniprot ID: O15466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS
• Gene Sequence: SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS
• Gene ID - Mouse: ENSMUSG00000025425
• Gene ID - Rat: ENSRNOG00000022691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.