Anti ST8SIA5 pAb (ATL-HPA046771)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046771-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ST8SIA5
Alternative Gene Name: SIAT8E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025425: 85%, ENSRNOG00000022691: 85%
Entrez Gene ID: 29906
Uniprot ID: O15466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS |
| Gene Sequence | SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS |
| Gene ID - Mouse | ENSMUSG00000025425 |
| Gene ID - Rat | ENSRNOG00000022691 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ST8SIA5 pAb (ATL-HPA046771) | |
| Datasheet | Anti ST8SIA5 pAb (ATL-HPA046771) Datasheet (External Link) |
| Vendor Page | Anti ST8SIA5 pAb (ATL-HPA046771) at Atlas Antibodies |
| Documents & Links for Anti ST8SIA5 pAb (ATL-HPA046771) | |
| Datasheet | Anti ST8SIA5 pAb (ATL-HPA046771) Datasheet (External Link) |
| Vendor Page | Anti ST8SIA5 pAb (ATL-HPA046771) |