Anti ST8SIA5 pAb (ATL-HPA046771)

Atlas Antibodies

Catalog No.:
ATL-HPA046771-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5
Gene Name: ST8SIA5
Alternative Gene Name: SIAT8E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025425: 85%, ENSRNOG00000022691: 85%
Entrez Gene ID: 29906
Uniprot ID: O15466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS
Gene Sequence SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS
Gene ID - Mouse ENSMUSG00000025425
Gene ID - Rat ENSRNOG00000022691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST8SIA5 pAb (ATL-HPA046771)
Datasheet Anti ST8SIA5 pAb (ATL-HPA046771) Datasheet (External Link)
Vendor Page Anti ST8SIA5 pAb (ATL-HPA046771) at Atlas Antibodies

Documents & Links for Anti ST8SIA5 pAb (ATL-HPA046771)
Datasheet Anti ST8SIA5 pAb (ATL-HPA046771) Datasheet (External Link)
Vendor Page Anti ST8SIA5 pAb (ATL-HPA046771)