Anti ST5 pAb (ATL-HPA046796)

Atlas Antibodies

Catalog No.: ATL-HPA046796-25

Protein Description: suppression of tumorigenicity 5
Gene Name: ST5
Alternative Gene Name: DENND2B, HTS1, p126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031024: 94%, ENSRNOG00000013934: 65%
Entrez Gene ID: 6764
Uniprot ID: P78524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK
• Gene Sequence: PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK
• Gene ID - Mouse: ENSMUSG00000031024
• Gene ID - Rat: ENSRNOG00000013934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.