Anti ST5 pAb (ATL-HPA046796)

Atlas Antibodies

Catalog No.:
ATL-HPA046796-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: suppression of tumorigenicity 5
Gene Name: ST5
Alternative Gene Name: DENND2B, HTS1, p126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031024: 94%, ENSRNOG00000013934: 65%
Entrez Gene ID: 6764
Uniprot ID: P78524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK
Gene Sequence PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK
Gene ID - Mouse ENSMUSG00000031024
Gene ID - Rat ENSRNOG00000013934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST5 pAb (ATL-HPA046796)
Datasheet Anti ST5 pAb (ATL-HPA046796) Datasheet (External Link)
Vendor Page Anti ST5 pAb (ATL-HPA046796) at Atlas Antibodies

Documents & Links for Anti ST5 pAb (ATL-HPA046796)
Datasheet Anti ST5 pAb (ATL-HPA046796) Datasheet (External Link)
Vendor Page Anti ST5 pAb (ATL-HPA046796)