Anti ST3GAL5 pAb (ATL-HPA040425)

Atlas Antibodies

Catalog No.:
ATL-HPA040425-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Name: ST3GAL5
Alternative Gene Name: SIAT9, SIATGM3S, ST3GalV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056091: 81%, ENSRNOG00000010284: 79%
Entrez Gene ID: 8869
Uniprot ID: Q9UNP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
Gene Sequence FGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
Gene ID - Mouse ENSMUSG00000056091
Gene ID - Rat ENSRNOG00000010284
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST3GAL5 pAb (ATL-HPA040425)
Datasheet Anti ST3GAL5 pAb (ATL-HPA040425) Datasheet (External Link)
Vendor Page Anti ST3GAL5 pAb (ATL-HPA040425) at Atlas Antibodies

Documents & Links for Anti ST3GAL5 pAb (ATL-HPA040425)
Datasheet Anti ST3GAL5 pAb (ATL-HPA040425) Datasheet (External Link)
Vendor Page Anti ST3GAL5 pAb (ATL-HPA040425)