Anti ST3GAL3 pAb (ATL-HPA051102 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA051102-25

Protein Description: ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Gene Name: ST3GAL3
Alternative Gene Name: MRT12, SIAT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028538: 90%, ENSRNOG00000019843: 90%
Entrez Gene ID: 6487
Uniprot ID: Q11203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF
• Gene Sequence: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF
• Gene ID - Mouse: ENSMUSG00000028538
• Gene ID - Rat: ENSRNOG00000019843
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.