Anti SRSF10 pAb (ATL-HPA053805)

Atlas Antibodies

Catalog No.:
ATL-HPA053805-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: serine/arginine-rich splicing factor 10
Gene Name: SRSF10
Alternative Gene Name: FUSIP1, FUSIP2, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR1, TASR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028676: 100%, ENSRNOG00000007992: 100%
Entrez Gene ID: 10772
Uniprot ID: O75494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR
Gene Sequence DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR
Gene ID - Mouse ENSMUSG00000028676
Gene ID - Rat ENSRNOG00000007992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SRSF10 pAb (ATL-HPA053805)
Datasheet Anti SRSF10 pAb (ATL-HPA053805) Datasheet (External Link)
Vendor Page Anti SRSF10 pAb (ATL-HPA053805) at Atlas Antibodies

Documents & Links for Anti SRSF10 pAb (ATL-HPA053805)
Datasheet Anti SRSF10 pAb (ATL-HPA053805) Datasheet (External Link)
Vendor Page Anti SRSF10 pAb (ATL-HPA053805)