Anti SRSF10 pAb (ATL-HPA053805)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053805-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SRSF10
Alternative Gene Name: FUSIP1, FUSIP2, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR1, TASR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028676: 100%, ENSRNOG00000007992: 100%
Entrez Gene ID: 10772
Uniprot ID: O75494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR |
| Gene Sequence | DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR |
| Gene ID - Mouse | ENSMUSG00000028676 |
| Gene ID - Rat | ENSRNOG00000007992 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRSF10 pAb (ATL-HPA053805) | |
| Datasheet | Anti SRSF10 pAb (ATL-HPA053805) Datasheet (External Link) |
| Vendor Page | Anti SRSF10 pAb (ATL-HPA053805) at Atlas Antibodies |
| Documents & Links for Anti SRSF10 pAb (ATL-HPA053805) | |
| Datasheet | Anti SRSF10 pAb (ATL-HPA053805) Datasheet (External Link) |
| Vendor Page | Anti SRSF10 pAb (ATL-HPA053805) |