Anti SRSF10 pAb (ATL-HPA053805)

Atlas Antibodies

SKU: ATL-HPA053805-25

• 

Protein Description: serine/arginine-rich splicing factor 10
Gene Name: SRSF10
Alternative Gene Name: FUSIP1, FUSIP2, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR1, TASR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028676: 100%, ENSRNOG00000007992: 100%
Entrez Gene ID: 10772
Uniprot ID: O75494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR
• Gene Sequence: DRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSR
• Gene ID - Mouse: ENSMUSG00000028676
• Gene ID - Rat: ENSRNOG00000007992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.