Anti SRRM5 pAb (ATL-HPA047399)

Atlas Antibodies

Catalog No.:
ATL-HPA047399-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: serine/arginine repetitive matrix 5
Gene Name: SRRM5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064302: 31%, ENSRNOG00000050032: 53%
Entrez Gene ID: 100170229
Uniprot ID: B3KS81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSKPSMSLAPSGSSMPTADPKPPASLKSTKSATPNRSLVPTKPATSRNSVMSPSSSKSTKSTSTKRAPSNRPSSRSRVRSKARTPSRVSTDTRTSKASKASDVRCHQR
Gene Sequence SSKPSMSLAPSGSSMPTADPKPPASLKSTKSATPNRSLVPTKPATSRNSVMSPSSSKSTKSTSTKRAPSNRPSSRSRVRSKARTPSRVSTDTRTSKASKASDVRCHQR
Gene ID - Mouse ENSMUSG00000064302
Gene ID - Rat ENSRNOG00000050032
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SRRM5 pAb (ATL-HPA047399)
Datasheet Anti SRRM5 pAb (ATL-HPA047399) Datasheet (External Link)
Vendor Page Anti SRRM5 pAb (ATL-HPA047399) at Atlas Antibodies

Documents & Links for Anti SRRM5 pAb (ATL-HPA047399)
Datasheet Anti SRRM5 pAb (ATL-HPA047399) Datasheet (External Link)
Vendor Page Anti SRRM5 pAb (ATL-HPA047399)