Anti SRRM5 pAb (ATL-HPA047399)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047399-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SRRM5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064302: 31%, ENSRNOG00000050032: 53%
Entrez Gene ID: 100170229
Uniprot ID: B3KS81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSKPSMSLAPSGSSMPTADPKPPASLKSTKSATPNRSLVPTKPATSRNSVMSPSSSKSTKSTSTKRAPSNRPSSRSRVRSKARTPSRVSTDTRTSKASKASDVRCHQR |
Gene Sequence | SSKPSMSLAPSGSSMPTADPKPPASLKSTKSATPNRSLVPTKPATSRNSVMSPSSSKSTKSTSTKRAPSNRPSSRSRVRSKARTPSRVSTDTRTSKASKASDVRCHQR |
Gene ID - Mouse | ENSMUSG00000064302 |
Gene ID - Rat | ENSRNOG00000050032 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SRRM5 pAb (ATL-HPA047399) | |
Datasheet | Anti SRRM5 pAb (ATL-HPA047399) Datasheet (External Link) |
Vendor Page | Anti SRRM5 pAb (ATL-HPA047399) at Atlas Antibodies |
Documents & Links for Anti SRRM5 pAb (ATL-HPA047399) | |
Datasheet | Anti SRRM5 pAb (ATL-HPA047399) Datasheet (External Link) |
Vendor Page | Anti SRRM5 pAb (ATL-HPA047399) |