Anti SRRM2 pAb (ATL-HPA041411)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041411-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SRRM2
Alternative Gene Name: Cwc21, KIAA0324, SRL300, SRm300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039218: 60%, ENSRNOG00000058561: 60%
Entrez Gene ID: 23524
Uniprot ID: Q9UQ35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFK |
| Gene Sequence | RSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFK |
| Gene ID - Mouse | ENSMUSG00000039218 |
| Gene ID - Rat | ENSRNOG00000058561 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRRM2 pAb (ATL-HPA041411) | |
| Datasheet | Anti SRRM2 pAb (ATL-HPA041411) Datasheet (External Link) |
| Vendor Page | Anti SRRM2 pAb (ATL-HPA041411) at Atlas Antibodies |
| Documents & Links for Anti SRRM2 pAb (ATL-HPA041411) | |
| Datasheet | Anti SRRM2 pAb (ATL-HPA041411) Datasheet (External Link) |
| Vendor Page | Anti SRRM2 pAb (ATL-HPA041411) |
| Citations for Anti SRRM2 pAb (ATL-HPA041411) – 1 Found |
| Legartová, Soňa; Fagherazzi, Paolo; Stixová, Lenka; Kovařík, Aleš; Raška, Ivan; Bártová, Eva. The SC-35 Splicing Factor Interacts with RNA Pol II and A-Type Lamin Depletion Weakens This Interaction. Cells. 2021;10(2) PubMed |