Anti SRP72 pAb (ATL-HPA034621)

Atlas Antibodies

Catalog No.: ATL-HPA034621-25

Protein Description: signal recognition particle 72kDa
Gene Name: SRP72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036323: 98%, ENSRNOG00000002100: 99%
Entrez Gene ID: 6731
Uniprot ID: O76094
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACA
• Gene Sequence: ENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACA
• Gene ID - Mouse: ENSMUSG00000036323
• Gene ID - Rat: ENSRNOG00000002100
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRP72 pAb (ATL-HPA034621) – 1 Found

Kirwan, Michael; Walne, Amanda J; Plagnol, Vincent; Velangi, Mark; Ho, Aloysius; Hossain, Upal; Vulliamy, Tom; Dokal, Inderjeet. Exome sequencing identifies autosomal-dominant SRP72 mutations associated with familial aplasia and myelodysplasia. American Journal Of Human Genetics. 2012;90(5):888-92.