Anti SRGN pAb (ATL-HPA000759 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000759-25

Protein Description: serglycin
Gene Name: SRGN
Alternative Gene Name: PPG, PRG, PRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020077: 53%, ENSRNOG00000000394: 55%
Entrez Gene ID: 5552
Uniprot ID: P10124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
• Gene Sequence: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
• Gene ID - Mouse: ENSMUSG00000020077
• Gene ID - Rat: ENSRNOG00000000394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRGN pAb (ATL-HPA000759 w/enhanced validation) – 9 Found

Reine, Trine M; Vuong, Tram T; Rutkovskiy, Arkady; Meen, Astri J; Vaage, Jarle; Jenssen, Trond G; Kolset, Svein O. Serglycin in Quiescent and Proliferating Primary Endothelial Cells. Plos One. 10(12):e0145584. 

Roy, Ananya; Attarha, Sanaz; Weishaupt, Holger; Edqvist, Per-Henrik; Swartling, Fredrik J; Bergqvist, Michael; Siebzehnrubl, Florian A; Smits, Anja; Pontén, Fredrik; Tchougounova, Elena. Serglycin as a potential biomarker for glioma: association of serglycin expression, extent of mast cell recruitment and glioblastoma progression. Oncotarget. 2017;8(15):24815-24827. 

Pantazopoulos, Harry; Katsel, Pavel; Haroutunian, Vahram; Chelini, Gabriele; Klengel, Torsten; Berretta, Sabina. Molecular signature of extracellular matrix pathology in schizophrenia. The European Journal Of Neuroscience. 2021;53(12):3960-3987. 

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. 

Chang, Mary Y; Chan, Christina K; Braun, Kathleen R; Green, Pattie S; O'Brien, Kevin D; Chait, Alan; Day, Anthony J; Wight, Thomas N. Monocyte-to-macrophage differentiation: synthesis and secretion of a complex extracellular matrix. The Journal Of Biological Chemistry. 2012;287(17):14122-35. 

Purushothaman, Anurag; Toole, Bryan P. Serglycin proteoglycan is required for multiple myeloma cell adhesion, in vivo growth, and vascularization. The Journal Of Biological Chemistry. 2014;289(9):5499-509. 

Guo, J-Y; Hsu, H-S; Tyan, S-W; Li, F-Y; Shew, J-Y; Lee, W-H; Chen, J-Y. Serglycin in tumor microenvironment promotes non-small cell lung cancer aggressiveness in a CD44-dependent manner. Oncogene. 2017;36(17):2457-2471. 

Guo, Jing-You; Chiu, Chu-Hsuan; Wang, Mei-Jung; Li, Fu-An; Chen, Jeou-Yuan. Proteoglycan serglycin promotes non-small cell lung cancer cell migration through the interaction of its glycosaminoglycans with CD44. Journal Of Biomedical Science. 2020;27(1):2. 

Zhu, Yun; Lam, Alfred K Y; Shum, Daisy K Y; Cui, Di; Zhang, Jun; Yan, Dong Dong; Li, Bin; Xu, Wen Wen; Lee, Nikki P Y; Chan, Kin Tak; Law, Simon; Tsao, Sai Wah; Cheung, Annie L M. Significance of serglycin and its binding partners in autocrine promotion of metastasis in esophageal cancer. Theranostics. 11(6):2722-2741.