Anti SRF pAb (ATL-HPA001819)

Atlas Antibodies

Catalog No.: ATL-HPA001819-25

Protein Description: serum response factor (c-fos serum response element-binding transcription factor)
Gene Name: SRF
Alternative Gene Name: MCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015605: 98%, ENSRNOG00000018232: 98%
Entrez Gene ID: 6722
Uniprot ID: P11831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQ
• Gene Sequence: LPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQ
• Gene ID - Mouse: ENSMUSG00000015605
• Gene ID - Rat: ENSRNOG00000018232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRF pAb (ATL-HPA001819) – 3 Found

Qiao, Juanli; Liu, Zhaojun; Yang, Chen; Gu, Liankun; Deng, Dajun. SRF promotes gastric cancer metastasis through stromal fibroblasts in an SDF1-CXCR4-dependent manner. Oncotarget. 2016;7(29):46088-46099. 

Härmä, V; Knuuttila, M; Virtanen, J; Mirtti, T; Kohonen, P; Kovanen, P; Happonen, A; Kaewphan, S; Ahonen, I; Kallioniemi, O; Grafström, R; Lötjönen, J; Nees, M. Lysophosphatidic acid and sphingosine-1-phosphate promote morphogenesis and block invasion of prostate cancer cells in three-dimensional organotypic models. Oncogene. 2012;31(16):2075-89. 

Bernau, Ksenija; Leet, Jonathan Paul; Bruhn, Ellen Marie; Tubbs, Austin James; Zhu, Terry; Sandbo, Nathan. Expression of serum response factor in the lung mesenchyme is essential for development of pulmonary fibrosis. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2021;321(1):L174-L188.