Anti SREK1IP1 pAb (ATL-HPA045677 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045677-100

Protein Description: SREK1-interacting protein 1
Gene Name: SREK1IP1
Alternative Gene Name: FLJ36754, P18SRP, SFRS12IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021716: 96%, ENSRNOG00000047506: 94%
Entrez Gene ID: 285672
Uniprot ID: Q8N9Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDS
• Gene Sequence: MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDS
• Gene ID - Mouse: ENSMUSG00000021716
• Gene ID - Rat: ENSRNOG00000047506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.