Anti SPTBN1 pAb (ATL-HPA013149)

Atlas Antibodies

Catalog No.:
ATL-HPA013149-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: spectrin, beta, non-erythrocytic 1
Gene Name: SPTBN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020315: 94%, ENSRNOG00000005434: 94%
Entrez Gene ID: 6711
Uniprot ID: Q01082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKE
Gene Sequence SLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKE
Gene ID - Mouse ENSMUSG00000020315
Gene ID - Rat ENSRNOG00000005434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPTBN1 pAb (ATL-HPA013149)
Datasheet Anti SPTBN1 pAb (ATL-HPA013149) Datasheet (External Link)
Vendor Page Anti SPTBN1 pAb (ATL-HPA013149) at Atlas Antibodies

Documents & Links for Anti SPTBN1 pAb (ATL-HPA013149)
Datasheet Anti SPTBN1 pAb (ATL-HPA013149) Datasheet (External Link)
Vendor Page Anti SPTBN1 pAb (ATL-HPA013149)
Citations for Anti SPTBN1 pAb (ATL-HPA013149) – 1 Found
Qundos, Ulrika; Drobin, Kimi; Mattsson, Cecilia; Hong, Mun-Gwan; Sjöberg, Ronald; Forsström, Björn; Solomon, David; Uhlén, Mathias; Nilsson, Peter; Michaëlsson, Karl; Schwenk, Jochen M. Affinity proteomics discovers decreased levels of AMFR in plasma from Osteoporosis patients. Proteomics. Clinical Applications. 2016;10(6):681-90.  PubMed