Anti SPINT2 pAb (ATL-HPA011101)

Atlas Antibodies

Catalog No.:
ATL-HPA011101-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serine peptidase inhibitor, Kunitz type, 2
Gene Name: SPINT2
Alternative Gene Name: HAI-2, Kop
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074227: 73%, ENSRNOG00000020636: 70%
Entrez Gene ID: 10653
Uniprot ID: O43291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE
Gene Sequence CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE
Gene ID - Mouse ENSMUSG00000074227
Gene ID - Rat ENSRNOG00000020636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPINT2 pAb (ATL-HPA011101)
Datasheet Anti SPINT2 pAb (ATL-HPA011101) Datasheet (External Link)
Vendor Page Anti SPINT2 pAb (ATL-HPA011101) at Atlas Antibodies

Documents & Links for Anti SPINT2 pAb (ATL-HPA011101)
Datasheet Anti SPINT2 pAb (ATL-HPA011101) Datasheet (External Link)
Vendor Page Anti SPINT2 pAb (ATL-HPA011101)
Citations for Anti SPINT2 pAb (ATL-HPA011101) – 6 Found
Ma, Zhiqiang; Liu, Dong; Li, Weimiao; Di, Shouyin; Zhang, Zhipei; Zhang, Jiao; Xu, Liqun; Guo, Kai; Zhu, Yifang; Han, Jing; Li, Xiaofei; Yan, Xiaolong. STYK1 promotes tumor growth and metastasis by reducing SPINT2/HAI-2 expression in non-small cell lung cancer. Cell Death & Disease. 2019;10(6):435.  PubMed
Ramirez Alvarez, Carlos; Kee, Carmon; Sharma, Ashwini Kumar; Thomas, Leonie; Schmidt, Florian I; Stanifer, Megan L; Boulant, Steeve; Herrmann, Carl. The endogenous cellular protease inhibitor SPINT2 controls SARS-CoV-2 viral infection and is associated to disease severity. Plos Pathogens. 2021;17(6):e1009687.  PubMed
Friis, Stine; Sales, Katiuchia Uzzun; Schafer, Jeffrey Martin; Vogel, Lotte K; Kataoka, Hiroaki; Bugge, Thomas H. The protease inhibitor HAI-2, but not HAI-1, regulates matriptase activation and shedding through prostasin. The Journal Of Biological Chemistry. 2014;289(32):22319-32.  PubMed
Pereira, Márcia Santos; de Almeida, Gisele Caravina; Pinto, Filipe; Viana-Pereira, Marta; Reis, Rui Manuel. SPINT2 Deregulation in Prostate Carcinoma. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2016;64(1):32-41.  PubMed
Wu, Chuan-Jin; Feng, Xu; Lu, Michael; Morimura, Sohshi; Udey, Mark C. Matriptase-mediated cleavage of EpCAM destabilizes claudins and dysregulates intestinal epithelial homeostasis. The Journal Of Clinical Investigation. 2017;127(2):623-634.  PubMed
Wu, Chuan-Jin; Lu, Michael; Feng, Xu; Nakato, Gaku; Udey, Mark C. Matriptase Cleaves EpCAM and TROP2 in Keratinocytes, Destabilizing Both Proteins and Associated Claudins. Cells. 2020;9(4)  PubMed