Anti SPG21 pAb (ATL-HPA040407)

Atlas Antibodies

Catalog No.:
ATL-HPA040407-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Gene Name: SPG21
Alternative Gene Name: ACP33, BM-019, GL010, MAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032388: 95%, ENSRNOG00000015019: 92%
Entrez Gene ID: 51324
Uniprot ID: Q9NZD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Gene Sequence AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Gene ID - Mouse ENSMUSG00000032388
Gene ID - Rat ENSRNOG00000015019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPG21 pAb (ATL-HPA040407)
Datasheet Anti SPG21 pAb (ATL-HPA040407) Datasheet (External Link)
Vendor Page Anti SPG21 pAb (ATL-HPA040407) at Atlas Antibodies

Documents & Links for Anti SPG21 pAb (ATL-HPA040407)
Datasheet Anti SPG21 pAb (ATL-HPA040407) Datasheet (External Link)
Vendor Page Anti SPG21 pAb (ATL-HPA040407)