Anti SPG11 pAb (ATL-HPA040947)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040947-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SPG11
Alternative Gene Name: FLJ21439, KIAA1840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033396: 65%, ENSRNOG00000021954: 66%
Entrez Gene ID: 80208
Uniprot ID: Q96JI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLHNMKLSISYLRECAKANDWLQFIIHSQLHNYHPAEVKSLIQYFSPVIQDHLRLAFENLPSVPTSKMDSDQVCNKCPQELQGSKQEMTDLFEILLQCS |
| Gene Sequence | RLHNMKLSISYLRECAKANDWLQFIIHSQLHNYHPAEVKSLIQYFSPVIQDHLRLAFENLPSVPTSKMDSDQVCNKCPQELQGSKQEMTDLFEILLQCS |
| Gene ID - Mouse | ENSMUSG00000033396 |
| Gene ID - Rat | ENSRNOG00000021954 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPG11 pAb (ATL-HPA040947) | |
| Datasheet | Anti SPG11 pAb (ATL-HPA040947) Datasheet (External Link) |
| Vendor Page | Anti SPG11 pAb (ATL-HPA040947) at Atlas Antibodies |
| Documents & Links for Anti SPG11 pAb (ATL-HPA040947) | |
| Datasheet | Anti SPG11 pAb (ATL-HPA040947) Datasheet (External Link) |
| Vendor Page | Anti SPG11 pAb (ATL-HPA040947) |