Anti SPG11 pAb (ATL-HPA040947)

Atlas Antibodies

Catalog No.: ATL-HPA040947-25

Protein Description: spastic paraplegia 11 (autosomal recessive)
Gene Name: SPG11
Alternative Gene Name: FLJ21439, KIAA1840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033396: 65%, ENSRNOG00000021954: 66%
Entrez Gene ID: 80208
Uniprot ID: Q96JI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLHNMKLSISYLRECAKANDWLQFIIHSQLHNYHPAEVKSLIQYFSPVIQDHLRLAFENLPSVPTSKMDSDQVCNKCPQELQGSKQEMTDLFEILLQCS
• Gene Sequence: RLHNMKLSISYLRECAKANDWLQFIIHSQLHNYHPAEVKSLIQYFSPVIQDHLRLAFENLPSVPTSKMDSDQVCNKCPQELQGSKQEMTDLFEILLQCS
• Gene ID - Mouse: ENSMUSG00000033396
• Gene ID - Rat: ENSRNOG00000021954
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.