Anti SPDYA pAb (ATL-HPA035162)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035162-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SPDYA
Alternative Gene Name: Ringo3, SPDY1, SPY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 97%, ENSRNOG00000004534: 94%
Entrez Gene ID: 245711
Uniprot ID: Q5MJ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS |
| Gene Sequence | CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS |
| Gene ID - Mouse | ENSMUSG00000052525 |
| Gene ID - Rat | ENSRNOG00000004534 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPDYA pAb (ATL-HPA035162) | |
| Datasheet | Anti SPDYA pAb (ATL-HPA035162) Datasheet (External Link) |
| Vendor Page | Anti SPDYA pAb (ATL-HPA035162) at Atlas Antibodies |
| Documents & Links for Anti SPDYA pAb (ATL-HPA035162) | |
| Datasheet | Anti SPDYA pAb (ATL-HPA035162) Datasheet (External Link) |
| Vendor Page | Anti SPDYA pAb (ATL-HPA035162) |