Anti SPDL1 pAb (ATL-HPA044700 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044700-25

Protein Description: spindle apparatus coiled-coil protein 1
Gene Name: SPDL1
Alternative Gene Name: CCDC99, FLJ20364, hSpindly
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069910: 55%, ENSRNOG00000007292: 50%
Entrez Gene ID: 54908
Uniprot ID: Q96EA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSCPNSLEDNNLQLEKSVSIHTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADA
• Gene Sequence: YEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSCPNSLEDNNLQLEKSVSIHTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADA
• Gene ID - Mouse: ENSMUSG00000069910
• Gene ID - Rat: ENSRNOG00000007292
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPDL1 pAb (ATL-HPA044700 w/enhanced validation) – 2 Found

Monteiro, L; Silva, P; Delgado, L; Amaral, B; Garcês, F; Salazar, F; Pacheco, J-J; Lopes, C; Bousbaa, H; Warnakulasuriya, S. Expression of spindle assembly checkpoint proteins BubR1 and Mad2 expression as potential biomarkers of malignant transformation of oral leukoplakia: an observational cohort study. Medicina Oral, Patologia Oral Y Cirugia Bucal. 2021;26(6):e719-e728. 

Delgado, Leonor; Monteiro, Luís; Silva, Patrícia; Bousbaa, Hassan; Garcez, Fernanda; Silva, João; Brilhante-Simões, Paula; Pires, Isabel; Prada, Justina. BUBR1 as a Prognostic Biomarker in Canine Oral Squamous Cell Carcinoma. Animals : An Open Access Journal From Mdpi. 2022;12(22)