Anti SPC24 pAb (ATL-HPA051234)

Atlas Antibodies

Catalog No.:
ATL-HPA051234-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SPC24, NDC80 kinetochore complex component
Gene Name: SPC24
Alternative Gene Name: FLJ90806, SPBC24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074476: 85%, ENSRNOG00000029862: 91%
Entrez Gene ID: 147841
Uniprot ID: Q8NBT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV
Gene Sequence ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV
Gene ID - Mouse ENSMUSG00000074476
Gene ID - Rat ENSRNOG00000029862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPC24 pAb (ATL-HPA051234)
Datasheet Anti SPC24 pAb (ATL-HPA051234) Datasheet (External Link)
Vendor Page Anti SPC24 pAb (ATL-HPA051234) at Atlas Antibodies

Documents & Links for Anti SPC24 pAb (ATL-HPA051234)
Datasheet Anti SPC24 pAb (ATL-HPA051234) Datasheet (External Link)
Vendor Page Anti SPC24 pAb (ATL-HPA051234)