Anti SPAG5 pAb (ATL-HPA022008)

Atlas Antibodies

Catalog No.: ATL-HPA022008-25

Protein Description: sperm associated antigen 5
Gene Name: SPAG5
Alternative Gene Name: DEEPEST, hMAP126, MAP126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002055: 63%, ENSRNOG00000011777: 60%
Entrez Gene ID: 10615
Uniprot ID: Q96R06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSL
• Gene Sequence: DTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSL
• Gene ID - Mouse: ENSMUSG00000002055
• Gene ID - Rat: ENSRNOG00000011777
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPAG5 pAb (ATL-HPA022008) – 5 Found

Abdalla, Moustafa; Tran-Thanh, Danh; Moreno, Juan; Iakovlev, Vladimir; Nair, Ranju; Kanwar, Nisha; Abdalla, Mohamed; Lee, Jennifer P Y; Kwan, Jennifer Yin Yee; Cawthorn, Thomas R; Warren, Keisha; Arneson, Nona; Wang, Dong-Yu; Fox, Natalie S; Youngson, Bruce J; Miller, Naomi A; Easson, Alexandra M; McCready, David; Leong, Wey L; Boutros, Paul C; Done, Susan J. Mapping genomic and transcriptomic alterations spatially in epithelial cells adjacent to human breast carcinoma. Nature Communications. 2017;8(1):1245. 

Zhou, Xiaoli; Jia, Lizhou; Sun, Yangyang; Xu, Lingyun; Wang, Xudong; Tang, Qi. Sperm-associated antigen 5 is a potential biomarker for poor prognosis in breast cancer. Oncology Letters. 2019;17(1):1146-1152. 

Li, Qing; Wang, Yueming; He, Jingdong. MiR-133a-3p attenuates resistance of non-small cell lung cancer cells to gefitinib by targeting SPAG5. Journal Of Clinical Laboratory Analysis. 2021;35(7):e23853. 

Zhang, Mei; Sha, Ling; Hou, Ning; Shi, Chuanbing; Tan, Lin. High expression of sperm-associated antigen 5 correlates with poor survival in ovarian cancer. Bioscience Reports. 2020;40(2) 

Huang, Ruijia; Li, Aili. SPAG5 is associated with unfavorable prognosis in patients with lung adenocarcinoma and promotes proliferation, motility and autophagy in A549 cells. Experimental And Therapeutic Medicine. 2020;20(5):77.