Anti SP2 pAb (ATL-HPA003357)

Atlas Antibodies

Catalog No.: ATL-HPA003357-25

Protein Description: Sp2 transcription factor
Gene Name: SP2
Alternative Gene Name: KIAA0048
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018678: 86%, ENSRNOG00000010492: 89%
Entrez Gene ID: 6668
Uniprot ID: Q02086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSST
• Gene Sequence: KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSST
• Gene ID - Mouse: ENSMUSG00000018678
• Gene ID - Rat: ENSRNOG00000010492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SP2 pAb (ATL-HPA003357) – 2 Found

Kim, Tae-Hyung; Chiera, Shannon L; Linder, Keith E; Trempus, Carol S; Smart, Robert C; Horowitz, Jonathan M. Overexpression of transcription factor sp2 inhibits epidermal differentiation and increases susceptibility to wound- and carcinogen-induced tumorigenesis. Cancer Research. 2010;70(21):8507-16. 

Johnson, Caroline A; Ghashghaei, H Troy. Sp2 regulates late neurogenic but not early expansive divisions of neural stem cells underlying population growth in the mouse cortex. Development (Cambridge, England). 2020;147(4)