Anti SP110 pAb (ATL-HPA047036)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047036-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SP110
Alternative Gene Name: IFI41, IFI75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079808: 40%, ENSRNOG00000033747: 47%
Entrez Gene ID: 3431
Uniprot ID: Q9HB58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTS |
Gene Sequence | EPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTS |
Gene ID - Mouse | ENSMUSG00000079808 |
Gene ID - Rat | ENSRNOG00000033747 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SP110 pAb (ATL-HPA047036) | |
Datasheet | Anti SP110 pAb (ATL-HPA047036) Datasheet (External Link) |
Vendor Page | Anti SP110 pAb (ATL-HPA047036) at Atlas Antibodies |
Documents & Links for Anti SP110 pAb (ATL-HPA047036) | |
Datasheet | Anti SP110 pAb (ATL-HPA047036) Datasheet (External Link) |
Vendor Page | Anti SP110 pAb (ATL-HPA047036) |