Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001758-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: SOX9
Alternative Gene Name: CMD1, CMPD1, SRA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000567: 97%, ENSRNOG00000002607: 96%
Entrez Gene ID: 6662
Uniprot ID: P48436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR |
| Gene Sequence | SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR |
| Gene ID - Mouse | ENSMUSG00000000567 |
| Gene ID - Rat | ENSRNOG00000002607 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) | |
| Datasheet | Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) | |
| Datasheet | Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) |
| Citations for Anti SOX9 pAb (ATL-HPA001758 w/enhanced validation) – 32 Found |
| Fantinato, E; Milani, L; Sironi, G. Sox9 expression in canine epithelial skin tumors. European Journal Of Histochemistry : Ejh. 2015;59(3):2514. PubMed |
| Li, Lei; Newton, Phillip T; Bouderlique, Thibault; Sejnohova, Marie; Zikmund, Tomas; Kozhemyakina, Elena; Xie, Meng; Krivanek, Jan; Kaiser, Jozef; Qian, Hong; Dyachuk, Vyacheslav; Lassar, Andrew B; Warman, Matthew L; Barenius, Björn; Adameyko, Igor; Chagin, Andrei S. Superficial cells are self-renewing chondrocyte progenitors, which form the articular cartilage in juvenile mice. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2017;31(3):1067-1084. PubMed |
| Minkina, Anna; Lindeman, Robin E; Gearhart, Micah D; Chassot, Anne-Amandine; Chaboissier, Marie-Christine; Ghyselinck, Norbert B; Bardwell, Vivian J; Zarkower, David. Retinoic acid signaling is dispensable for somatic development and function in the mammalian ovary. Developmental Biology. 2017;424(2):208-220. PubMed |
| Del Valle, Ignacio; Buonocore, Federica; Duncan, Andrew J; Lin, Lin; Barenco, Martino; Parnaik, Rahul; Shah, Sonia; Hubank, Mike; Gerrelli, Dianne; Achermann, John C. A genomic atlas of human adrenal and gonad development. Wellcome Open Research. 2017;2( 28459107):25. PubMed |
| Landfors, Miriam; Johansen, Jostein; Aronsen, Jan Magnus; Vågbø, Cathrine Broberg; Doré, Louis C; He, Chuan; Sjaastad, Ivar; Sætrom, Pål; Fedorcsák, Péter; Dahl, John Arne; Aanes, Håvard; Fußer, Markus; Klungland, Arne. Genome-wide profiling of DNA 5-hydroxymethylcytosine during rat Sertoli cell maturation. Cell Discovery. 3( 28529766):17013. PubMed |
| Bombardo, Marta; Saponara, Enrica; Malagola, Ermanno; Chen, Rong; Seleznik, Gitta M; Haumaitre, Cecile; Quilichini, Evans; Zabel, Anja; Reding, Theresia; Graf, Rolf; Sonda, Sabrina. Class I histone deacetylase inhibition improves pancreatitis outcome by limiting leukocyte recruitment and acinar-to-ductal metaplasia. British Journal Of Pharmacology. 2017;174(21):3865-3880. PubMed |
| Sun, Qi; Wu, Gaoyi; Chen, Hang; Chen, Lei; Chen, Hongyu; Zhu, Guoxiong; Zhao, Huaqiang. Hyperbaric oxygen protects type II collagen in interleukin-1β-induced mandibular condylar chondrocyte via inhibiting the JNK/c-Jun signaling pathway. Oncotarget. 2017;8(36):60312-60323. PubMed |
| Sumita, Yoshimasa; Yamazaki, Manabu; Maruyama, Satoshi; Abé, Tatsuya; Cheng, Jun; Takagi, Ritsuo; Tanuma, Jun-Ichi. Cytoplasmic expression of SOX9 as a poor prognostic factor for oral squamous cell carcinoma. Oncology Reports. 2018;40(5):2487-2496. PubMed |
| Ruan, Shiqiang; Deng, Jiang; Yan, Ling; Huang, Wenliang. Evaluation of the effects of the combination of BMP-2-modified BMSCs and PRP on cartilage defects. Experimental And Therapeutic Medicine. 2018;16(6):4569-4577. PubMed |
| Vesela, Barbora; Svandova, Eva; Ramesova, Alice; Kratochvilova, Adela; Tucker, Abigail S; Matalova, Eva. Caspase Inhibition Affects the Expression of Autophagy-Related Molecules in Chondrocytes. Cartilage. 2021;13(2_suppl):956S-968S. PubMed |
| Le Rolle, Morgane; Massa, Filippo; Siggers, Pam; Turchi, Laurent; Loubat, Agnès; Koo, Bon-Kyoung; Clevers, Hans; Greenfield, Andy; Schedl, Andreas; Chaboissier, Marie-Christine; Chassot, Anne-Amandine. Arrest of WNT/β-catenin signaling enables the transition from pluripotent to differentiated germ cells in mouse ovaries. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(30) PubMed |
| Soleas, John P; Huang, Linwen; D'Arcangelo, Elisa; Nostro, Maria Cristina; Waddell, Thomas K; McGuigan, Alison P; Karoubi, Golnaz. Guided Self-Assembly of ES-Derived Lung Progenitors into Biomimetic Tube Structures That Impact Cell Differentiation. Bioengineering (Basel, Switzerland). 2021;8(12) PubMed |
| Ibragimova, Shabnam I; Medvedeva, Ekaterina V; Romanova, Irina A; Istranov, Leonid P; Istranova, Elena V; Lychagin, Aleksey V; Nedorubov, Andrey A; Timashev, Peter S; Telpukhov, Vladimir I; Chagin, Andrei S. Implantation of Various Cell-Free Matrixes Does Not Contribute to the Restoration of Hyaline Cartilage within Full-Thickness Focal Defects. International Journal Of Molecular Sciences. 2021;23(1) PubMed |
| Vestentoft, Peter S; Jelnes, Peter; Hopkinson, Branden M; Vainer, Ben; Møllgård, Kjeld; Quistorff, Bjørn; Bisgaard, Hanne C. Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver. Bmc Developmental Biology. 2011;11( 21943389):56. PubMed |
| Poulsen, R C; Knowles, H J; Carr, A J; Hulley, P A. Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure. Cell Death & Disease. 2014;5(2):e1074. PubMed |
| Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244. PubMed |
| Bruun, Jarle; Kolberg, Matthias; Nesland, Jahn M; Svindland, Aud; Nesbakken, Arild; Lothe, Ragnhild A. Prognostic Significance of β-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series. Frontiers In Oncology. 4( 24904831):118. PubMed |
| Capaccione, Kathleen M; Hong, Xuehui; Morgan, Katherine M; Liu, Wenyu; Bishop, J Michael; Liu, LianXin; Markert, Elke; Deen, Malik; Minerowicz, Christine; Bertino, Joseph R; Allen, Thaddeus; Pine, Sharon R. Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma. Oncotarget. 2014;5(11):3636-50. PubMed |
| Roy, Nilotpal; Malik, Shivani; Villanueva, Karina E; Urano, Atsushi; Lu, Xinyuan; Von Figura, Guido; Seeley, E Scott; Dawson, David W; Collisson, Eric A; Hebrok, Matthias. Brg1 promotes both tumor-suppressive and oncogenic activities at distinct stages of pancreatic cancer formation. Genes & Development. 2015;29(6):658-71. PubMed |
| Chen, Ya-Hui; Chen, Hui-Ling; Chien, Chin-Sung; Wu, Shang-Hsin; Ho, Yi-Tian; Yu, Chun-Hsien; Chang, Mei-Hwei. Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury. Plos One. 10(8):e0134327. PubMed |
| Kaucka, Marketa; Petersen, Julian; Tesarova, Marketa; Szarowska, Bara; Kastriti, Maria Eleni; Xie, Meng; Kicheva, Anna; Annusver, Karl; Kasper, Maria; Symmons, Orsolya; Pan, Leslie; Spitz, Francois; Kaiser, Jozef; Hovorakova, Maria; Zikmund, Tomas; Sunadome, Kazunori; Matise, Michael P; Wang, Hui; Marklund, Ulrika; Abdo, Hind; Ernfors, Patrik; Maire, Pascal; Wurmser, Maud; Chagin, Andrei S; Fried, Kaj; Adameyko, Igor. Signals from the brain and olfactory epithelium control shaping of the mammalian nasal capsule cartilage. Elife. 2018;7( 29897331) PubMed |
| Yuan, Xiaodong; Li, Jun; Coulouarn, Cédric; Lin, Tao; Sulpice, Laurent; Bergeat, Damien; De La Torre, Carolina; Liebe, Roman; Gretz, Norbert; Ebert, Matthias P A; Dooley, Steven; Weng, Hong-Lei. SOX9 expression decreases survival of patients with intrahepatic cholangiocarcinoma by conferring chemoresistance. British Journal Of Cancer. 2018;119(11):1358-1366. PubMed |
| Gignac, Sarah J; Hosseini-Farahabadi, Sara; Akazawa, Takashi; Schuck, Nathan J; Fu, Katherine; Richman, Joy M. Robinow syndrome skeletal phenotypes caused by the WNT5AC83S variant are due to dominant interference with chondrogenesis. Human Molecular Genetics. 2019;28(14):2395-2414. PubMed |
| Nguyen, Thi Minh Xuan; Vegrichtova, Marketa; Tlapakova, Tereza; Krulova, Magdalena; Krylov, Vladimir. The interconnection between cytokeratin and cell membrane-bound β-catenin in Sertoli cells derived from juvenile Xenopus tropicalis testes. Biology Open. 2019;8(12) PubMed |
| Matta, Csaba; Juhász, Tamás; Fodor, János; Hajdú, Tibor; Katona, Éva; Szűcs-Somogyi, Csilla; Takács, Roland; Vágó, Judit; Oláh, Tamás; Bartók, Ádám; Varga, Zoltan; Panyi, Gyorgy; Csernoch, László; Zákány, Róza. N-methyl-D-aspartate (NMDA) receptor expression and function is required for early chondrogenesis. Cell Communication And Signaling : Ccs. 2019;17(1):166. PubMed |
| Güven, Ayse; Kalebic, Nereo; Long, Katherine R; Florio, Marta; Vaid, Samir; Brandl, Holger; Stenzel, Denise; Huttner, Wieland B. Extracellular matrix-inducing Sox9 promotes both basal progenitor proliferation and gliogenesis in developing neocortex. Elife. 2020;9( 32191207) PubMed |
| Zhang, Yi; Annusver, Karl; Sunadome, Kazunori; Kameneva, Polina; Edwards, Steven; Lei, Guanghua; Kasper, Maria; Chagin, Andrei S; Adameyko, Igor; Xie, Meng. Epiphyseal Cartilage Formation Involves Differential Dynamics of Various Cellular Populations During Embryogenesis. Frontiers In Cell And Developmental Biology. 8( 32211405):122. PubMed |
| Richardson, Nainoa; Gillot, Isabelle; Gregoire, Elodie P; Youssef, Sameh A; de Rooij, Dirk; de Bruin, Alain; De Cian, Marie-Cécile; Chaboissier, Marie-Christine. Sox8 and Sox9 act redundantly for ovarian-to-testicular fate reprogramming in the absence of R-spondin1 in mouse sex reversals. Elife. 2020;9( 32450947) PubMed |
| Krivanek, Jan; Soldatov, Ruslan A; Kastriti, Maria Eleni; Chontorotzea, Tatiana; Herdina, Anna Nele; Petersen, Julian; Szarowska, Bara; Landova, Marie; Matejova, Veronika Kovar; Holla, Lydie Izakovicova; Kuchler, Ulrike; Zdrilic, Ivana Vidovic; Vijaykumar, Anushree; Balic, Anamaria; Marangoni, Pauline; Klein, Ophir D; Neves, Vitor C M; Yianni, Val; Sharpe, Paul T; Harkany, Tibor; Metscher, Brian D; Bajénoff, Marc; Mina, Mina; Fried, Kaj; Kharchenko, Peter V; Adameyko, Igor. Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth. Nature Communications. 2020;11(1):4816. PubMed |
| Khabyuk, Julia; Pröls, Felicitas; Draga, Margarethe; Scaal, Martin. Development of ribs and intercostal muscles in the chicken embryo. Journal Of Anatomy. 2022;241(3):831-845. PubMed |
| Campbell, Nathaniel R; Rao, Anjali; Hunter, Miranda V; Sznurkowska, Magdalena K; Briker, Luzia; Zhang, Maomao; Baron, Maayan; Heilmann, Silja; Deforet, Maxime; Kenny, Colin; Ferretti, Lorenza P; Huang, Ting-Hsiang; Perlee, Sarah; Garg, Manik; Nsengimana, Jérémie; Saini, Massimo; Montal, Emily; Tagore, Mohita; Newton-Bishop, Julia; Middleton, Mark R; Corrie, Pippa; Adams, David J; Rabbie, Roy; Aceto, Nicola; Levesque, Mitchell P; Cornell, Robert A; Yanai, Itai; Xavier, Joao B; White, Richard M. Cooperation between melanoma cell states promotes metastasis through heterotypic cluster formation. Developmental Cell. 2021;56(20):2808-2825.e10. PubMed |
| Walker, Christopher J; Chang, Hua; Henegar, Leah; Kashyap, Trinayan; Shacham, Sharon; Sommer, Josh; Wick, Michael J; Levy, Joan; Landesman, Yosef. Selinexor inhibits growth of patient derived chordomas in vivo as a single agent and in combination with abemaciclib through diverse mechanisms. Frontiers In Oncology. 12( 36059685):808021. PubMed |