Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006889-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SORT1
Alternative Gene Name: Gp95, NT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068747: 89%, ENSRNOG00000031814: 89%
Entrez Gene ID: 6272
Uniprot ID: Q99523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD |
| Gene Sequence | LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD |
| Gene ID - Mouse | ENSMUSG00000068747 |
| Gene ID - Rat | ENSRNOG00000031814 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) | |
| Datasheet | Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) | |
| Datasheet | Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) |
| Citations for Anti SORT1 pAb (ATL-HPA006889 w/enhanced validation) – 2 Found |
| Chen, Chun-Chi; Chiou, Shiow-Her; Yang, Cheng-Lin; Chow, Kuan-Chih; Lin, Tze-Yi; Chang, Hui-Wen; You, Weir-Chiang; Huang, Hisu-Wen; Chen, Chien-Min; Chen, Nien-Cheng; Chou, Fen-Pi; Chou, Ming-Chih. Secreted gelsolin desensitizes and induces apoptosis of infiltrated lymphocytes in prostate cancer. Oncotarget. 2017;8(44):77152-77167. PubMed |
| Campbell, Genevieve E; Bender, Hannah R; Parker, Grace A; Curry, Thomas E Jr; Duffy, Diane M. Neurotensin: A novel mediator of ovulation?. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2021;35(4):e21481. PubMed |