Anti SORD pAb (ATL-HPA040260 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040260-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: SORD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027227: 86%, ENSRNOG00000017291: 85%
Entrez Gene ID: 6652
Uniprot ID: Q00796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP |
| Gene Sequence | LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP |
| Gene ID - Mouse | ENSMUSG00000027227 |
| Gene ID - Rat | ENSRNOG00000017291 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SORD pAb (ATL-HPA040260 w/enhanced validation) | |
| Datasheet | Anti SORD pAb (ATL-HPA040260 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SORD pAb (ATL-HPA040260 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SORD pAb (ATL-HPA040260 w/enhanced validation) | |
| Datasheet | Anti SORD pAb (ATL-HPA040260 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SORD pAb (ATL-HPA040260 w/enhanced validation) |
| Citations for Anti SORD pAb (ATL-HPA040260 w/enhanced validation) – 1 Found |
| Uzozie, Anuli; Nanni, Paolo; Staiano, Teresa; Grossmann, Jonas; Barkow-Oesterreicher, Simon; Shay, Jerry W; Tiwari, Amit; Buffoli, Federico; Laczko, Endre; Marra, Giancarlo. Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study. Molecular & Cellular Proteomics : Mcp. 2014;13(5):1198-218. PubMed |