Anti SOGA3 pAb (ATL-HPA035388)

Atlas Antibodies

Catalog No.:
ATL-HPA035388-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SOGA family member 3
Gene Name: SOGA3
Alternative Gene Name: C6orf174, dJ403A15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038916: 97%, ENSRNOG00000012324: 99%
Entrez Gene ID:
Uniprot ID: Q5TF21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKS
Gene Sequence ELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKS
Gene ID - Mouse ENSMUSG00000038916
Gene ID - Rat ENSRNOG00000012324
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOGA3 pAb (ATL-HPA035388)
Datasheet Anti SOGA3 pAb (ATL-HPA035388) Datasheet (External Link)
Vendor Page Anti SOGA3 pAb (ATL-HPA035388) at Atlas Antibodies

Documents & Links for Anti SOGA3 pAb (ATL-HPA035388)
Datasheet Anti SOGA3 pAb (ATL-HPA035388) Datasheet (External Link)
Vendor Page Anti SOGA3 pAb (ATL-HPA035388)