Anti SOGA3 pAb (ATL-HPA035388)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035388-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SOGA3
Alternative Gene Name: C6orf174, dJ403A15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038916: 97%, ENSRNOG00000012324: 99%
Entrez Gene ID:
Uniprot ID: Q5TF21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKS |
| Gene Sequence | ELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKS |
| Gene ID - Mouse | ENSMUSG00000038916 |
| Gene ID - Rat | ENSRNOG00000012324 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SOGA3 pAb (ATL-HPA035388) | |
| Datasheet | Anti SOGA3 pAb (ATL-HPA035388) Datasheet (External Link) |
| Vendor Page | Anti SOGA3 pAb (ATL-HPA035388) at Atlas Antibodies |
| Documents & Links for Anti SOGA3 pAb (ATL-HPA035388) | |
| Datasheet | Anti SOGA3 pAb (ATL-HPA035388) Datasheet (External Link) |
| Vendor Page | Anti SOGA3 pAb (ATL-HPA035388) |