Anti SOGA1 pAb (ATL-HPA043992)

Atlas Antibodies

Catalog No.: ATL-HPA043992-25

Protein Description: suppressor of glucose, autophagy associated 1
Gene Name: SOGA1
Alternative Gene Name: C20orf117, dJ132F21.1, FLJ44670, KIAA0889, SOGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055485: 89%, ENSRNOG00000053240: 89%
Entrez Gene ID: 140710
Uniprot ID: O94964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESF
• Gene Sequence: LPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESF
• Gene ID - Mouse: ENSMUSG00000055485
• Gene ID - Rat: ENSRNOG00000053240
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.