Anti SOD3 pAb (ATL-HPA042110)

Atlas Antibodies

Catalog No.:
ATL-HPA042110-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: superoxide dismutase 3, extracellular
Gene Name: SOD3
Alternative Gene Name: EC-SOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072941: 53%, ENSRNOG00000003869: 50%
Entrez Gene ID: 6649
Uniprot ID: P08294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFG
Gene Sequence WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFG
Gene ID - Mouse ENSMUSG00000072941
Gene ID - Rat ENSRNOG00000003869
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOD3 pAb (ATL-HPA042110)
Datasheet Anti SOD3 pAb (ATL-HPA042110) Datasheet (External Link)
Vendor Page Anti SOD3 pAb (ATL-HPA042110) at Atlas Antibodies

Documents & Links for Anti SOD3 pAb (ATL-HPA042110)
Datasheet Anti SOD3 pAb (ATL-HPA042110) Datasheet (External Link)
Vendor Page Anti SOD3 pAb (ATL-HPA042110)