Anti SOD2 pAb (ATL-HPA001814)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001814-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: SOD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006818: 88%, ENSRNOG00000019048: 87%
Entrez Gene ID: 6648
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL |
| Gene Sequence | VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL |
| Gene ID - Mouse | ENSMUSG00000006818 |
| Gene ID - Rat | ENSRNOG00000019048 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SOD2 pAb (ATL-HPA001814) | |
| Datasheet | Anti SOD2 pAb (ATL-HPA001814) Datasheet (External Link) |
| Vendor Page | Anti SOD2 pAb (ATL-HPA001814) at Atlas Antibodies |
| Documents & Links for Anti SOD2 pAb (ATL-HPA001814) | |
| Datasheet | Anti SOD2 pAb (ATL-HPA001814) Datasheet (External Link) |
| Vendor Page | Anti SOD2 pAb (ATL-HPA001814) |
| Citations for Anti SOD2 pAb (ATL-HPA001814) – 16 Found |
| Liu, Xiaobin; Ward, Keith; Xavier, Christy; Jann, Jamieson; Clark, Abbot F; Pang, Iok-Hou; Wu, Hongli. The novel triterpenoid RTA 408 protects human retinal pigment epithelial cells against H2O2-induced cell injury via NF-E2-related factor 2 (Nrf2) activation. Redox Biology. 2016;8( 26773873):98-109. PubMed |
| Sun, Lin; Dutta, Rajesh K; Xie, Ping; Kanwar, Yashpal S. myo-Inositol Oxygenase Overexpression Accentuates Generation of Reactive Oxygen Species and Exacerbates Cellular Injury following High Glucose Ambience: A NEW MECHANISM RELEVANT TO THE PATHOGENESIS OF DIABETIC NEPHROPATHY. The Journal Of Biological Chemistry. 2016;291(11):5688-5707. PubMed |
| Hamsten, Carl; Wiklundh, Emil; Grönlund, Hans; Schwenk, Jochen M; Uhlén, Mathias; Eklund, Anders; Nilsson, Peter; Grunewald, Johan; Häggmark-Månberg, Anna. Elevated levels of FN1 and CCL2 in bronchoalveolar lavage fluid from sarcoidosis patients. Respiratory Research. 2016;17(1):69. PubMed |
| Vochyánová, Zora; Pokorná, Marie; Rotrekl, Dominik; Smékal, Václav; Fictum, Petr; Suchý, Pavel; Gajdziok, Jan; Šmejkal, Karel; Hošek, Jan. Prenylated flavonoid morusin protects against TNBS-induced colitis in rats. Plos One. 12(8):e0182464. PubMed |
| Karuppagounder, Saravanan S; Alin, Lauren; Chen, Yingxin; Brand, David; Bourassa, Megan W; Dietrich, Kristen; Wilkinson, Cassandra M; Nadeau, Colby A; Kumar, Amit; Perry, Steve; Pinto, John T; Darley-Usmar, Victor; Sanchez, Stephanie; Milne, Ginger L; Pratico, Domenico; Holman, Theodore R; Carmichael, S Thomas; Coppola, Giovanni; Colbourne, Frederick; Ratan, Rajiv R. N-acetylcysteine targets 5 lipoxygenase-derived, toxic lipids and can synergize with prostaglandin E(2) to inhibit ferroptosis and improve outcomes following hemorrhagic stroke in mice. Annals Of Neurology. 2018;84(6):854-872. PubMed |
| Lobo-Jarne, Teresa; Nývltová, Eva; Pérez-Pérez, Rafael; Timón-Gómez, Alba; Molinié, Thibaut; Choi, Austin; Mourier, Arnaud; Fontanesi, Flavia; Ugalde, Cristina; Barrientos, Antoni. Human COX7A2L Regulates Complex III Biogenesis and Promotes Supercomplex Organization Remodeling without Affecting Mitochondrial Bioenergetics. Cell Reports. 2018;25(7):1786-1799.e4. PubMed |
| Stock, Carmel J W; Michaeloudes, Charalambos; Leoni, Patricia; Durham, Andrew L; Mumby, Sharon; Wells, Athol U; Chung, Kian Fan; Adcock, Ian M; Renzoni, Elisabetta A; Lindahl, Gisela E. Bromodomain and Extraterminal (BET) Protein Inhibition Restores Redox Balance and Inhibits Myofibroblast Activation. Biomed Research International. 2019( 31119153):1484736. PubMed |
| Han, Sinsuk; Jeong, Yu Young; Sheshadri, Preethi; Su, Xiao; Cai, Qian. Mitophagy regulates integrity of mitochondria at synapses and is critical for synaptic maintenance. Embo Reports. 2020;21(9):e49801. PubMed |
| Kumar, Amit; Vaish, Manisha; Karuppagounder, Saravanan S; Gazaryan, Irina; Cave, John W; Starkov, Anatoly A; Anderson, Elizabeth T; Zhang, Sheng; Pinto, John T; Rountree, Austin M; Wang, Wang; Sweet, Ian R; Ratan, Rajiv R. HIF1α stabilization in hypoxia is not oxidant-initiated. Elife. 2021;10( 34596045) PubMed |
| Doni, Davide; Meggiolaro, Marta; Santos, Javier; Audran, Gérard; Marque, Sylvain R A; Costantini, Paola; Bortolus, Marco; Carbonera, Donatella. A Combined Spectroscopic and In Silico Approach to Evaluate the Interaction of Human Frataxin with Mitochondrial Superoxide Dismutase. Biomedicines. 2021;9(12) PubMed |
| Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
| Lindfors, Charlotte; Nilsson, Ida A K; Garcia-Roves, Pablo M; Zuberi, Aamir R; Karimi, Mohsen; Donahue, Leah Rae; Roopenian, Derry C; Mulder, Jan; Uhlén, Mathias; Ekström, Tomas J; Davisson, Muriel T; Hökfelt, Tomas G M; Schalling, Martin; Johansen, Jeanette E. Hypothalamic mitochondrial dysfunction associated with anorexia in the anx/anx mouse. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2011;108(44):18108-13. PubMed |
| Arimappamagan, Arivazhagan; Somasundaram, Kumaravel; Thennarasu, Kandavel; Peddagangannagari, Sreekanthreddy; Srinivasan, Harish; Shailaja, Bangalore C; Samuel, Cini; Patric, Irene Rosita Pia; Shukla, Sudhanshu; Thota, Balaram; Prasanna, Krishnarao Venkatesh; Pandey, Paritosh; Balasubramaniam, Anandh; Santosh, Vani; Chandramouli, Bangalore Ashwathnarayanara; Hegde, Alangar Sathyaranjandas; Kondaiah, Paturu; Sathyanarayana Rao, Manchanahalli R. A fourteen gene GBM prognostic signature identifies association of immune response pathway and mesenchymal subtype with high risk group. Plos One. 8(4):e62042. PubMed |
| Schaedlich, Kristina; Gebauer, Scarlett; Hunger, Luise; Beier, Laura-Sophie; Koch, Holger M; Wabitsch, Martin; Fischer, Bernd; Ernst, Jana. DEHP deregulates adipokine levels and impairs fatty acid storage in human SGBS-adipocytes. Scientific Reports. 2018;8(1):3447. PubMed |
| Morigi, Marina; Perico, Luca; Corna, Daniela; Locatelli, Monica; Cassis, Paola; Carminati, Claudia Elisa; Bolognini, Silvia; Zoja, Carlamaria; Remuzzi, Giuseppe; Benigni, Ariela; Buelli, Simona. C3a receptor blockade protects podocytes from injury in diabetic nephropathy. Jci Insight. 2020;5(5) PubMed |
| Treml, Jakub; Večeřová, Petra; Herczogová, Petra; Šmejkal, Karel. Direct and Indirect Antioxidant Effects of Selected Plant Phenolics in Cell-Based Assays. Molecules (Basel, Switzerland). 2021;26(9) PubMed |