Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001401-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: SOD1
Alternative Gene Name: ALS, ALS1, IPOA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022982: 82%, ENSRNOG00000002115: 81%
Entrez Gene ID: 6647
Uniprot ID: P00441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG |
| Gene Sequence | PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG |
| Gene ID - Mouse | ENSMUSG00000022982 |
| Gene ID - Rat | ENSRNOG00000002115 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) | |
| Datasheet | Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) | |
| Datasheet | Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) |
| Citations for Anti SOD1 pAb (ATL-HPA001401 w/enhanced validation) – 21 Found |
| Nichols, Nicole L; Satriotomo, Irawan; Harrigan, Daniel J; Mitchell, Gordon S. Acute intermittent hypoxia induced phrenic long-term facilitation despite increased SOD1 expression in a rat model of ALS. Experimental Neurology. 2015;273( 26287750):138-50. PubMed |
| Sun, Lin; Dutta, Rajesh K; Xie, Ping; Kanwar, Yashpal S. myo-Inositol Oxygenase Overexpression Accentuates Generation of Reactive Oxygen Species and Exacerbates Cellular Injury following High Glucose Ambience: A NEW MECHANISM RELEVANT TO THE PATHOGENESIS OF DIABETIC NEPHROPATHY. The Journal Of Biological Chemistry. 2016;291(11):5688-5707. PubMed |
| Amer, Mona G; Mazen, Nehad F; Mohamed, Ahmed M. Caffeine intake decreases oxidative stress and inflammatory biomarkers in experimental liver diseases induced by thioacetamide: Biochemical and histological study. International Journal Of Immunopathology And Pharmacology. 2017;30(1):13-24. PubMed |
| Madill, Martin; McDonagh, Katya; Ma, Jun; Vajda, Alice; McLoughlin, Paul; O'Brien, Timothy; Hardiman, Orla; Shen, Sanbing. Amyotrophic lateral sclerosis patient iPSC-derived astrocytes impair autophagy via non-cell autonomous mechanisms. Molecular Brain. 2017;10(1):22. PubMed |
| Tripathi, Pratibha; Rodriguez-Muela, Natalia; Klim, Joseph R; de Boer, A Sophie; Agrawal, Sahil; Sandoe, Jackson; Lopes, Claudia S; Ogliari, Karolyn Sassi; Williams, Luis A; Shear, Matthew; Rubin, Lee L; Eggan, Kevin; Zhou, Qiao. Reactive Astrocytes Promote ALS-like Degeneration and Intracellular Protein Aggregation in Human Motor Neurons by Disrupting Autophagy through TGF-β1. Stem Cell Reports. 2017;9(2):667-680. PubMed |
| Maruyama, Tomohiro; Baba, Takashi; Maemoto, Yuki; Hara-Miyauchi, Chikako; Hasegawa-Ogawa, Minami; Okano, Hirotaka James; Enda, Yuki; Matsumoto, Kei; Arimitsu, Nagisa; Nakao, Kazuki; Hamamoto, Hiroshi; Sekimizu, Kazuhisa; Ohto-Nakanishi, Takayo; Nakanishi, Hiroki; Tokuyama, Takeshi; Yanagi, Shigeru; Tagaya, Mitsuo; Tani, Katsuko. Loss of DDHD2, whose mutation causes spastic paraplegia, promotes reactive oxygen species generation and apoptosis. Cell Death & Disease. 2018;9(8):797. PubMed |
| Rando, Amaya; de la Torre, Miriam; Martinez-Muriana, Anna; Zaragoza, Pilar; Musaro, Antonio; Hernández, Sara; Navarro, Xavier; Toivonen, Janne M; Osta, Rosario. Chemotherapeutic agent 5-fluorouracil increases survival of SOD1 mouse model of ALS. Plos One. 14(1):e0210752. PubMed |
| Ceder, Sophia; Eriksson, Sofi E; Liang, Ying Yu; Cheteh, Emarndeena H; Zhang, Si Min; Fujihara, Kenji M; Bianchi, Julie; Bykov, Vladimir J N; Abrahmsen, Lars; Clemons, Nicholas J; Nordlund, Pär; Rudd, Sean G; Wiman, Klas G. Mutant p53-reactivating compound APR-246 synergizes with asparaginase in inducing growth suppression in acute lymphoblastic leukemia cells. Cell Death & Disease. 2021;12(7):709. PubMed |
| Miettinen, Teemu P; Björklund, Mikael. NQO2 is a reactive oxygen species generating off-target for acetaminophen. Molecular Pharmaceutics. 2014;11(12):4395-404. PubMed |
| Touat, Mehdi; Sourisseau, Tony; Dorvault, Nicolas; Chabanon, Roman M; Garrido, Marlène; Morel, Daphné; Krastev, Dragomir B; Bigot, Ludovic; Adam, Julien; Frankum, Jessica R; Durand, Sylvère; Pontoizeau, Clement; Souquère, Sylvie; Kuo, Mei-Shiue; Sauvaigo, Sylvie; Mardakheh, Faraz; Sarasin, Alain; Olaussen, Ken A; Friboulet, Luc; Bouillaud, Frédéric; Pierron, Gérard; Ashworth, Alan; Lombès, Anne; Lord, Christopher J; Soria, Jean-Charles; Postel-Vinay, Sophie. DNA repair deficiency sensitizes lung cancer cells to NAD+ biosynthesis blockade. The Journal Of Clinical Investigation. 2018;128(4):1671-1687. PubMed |
| Miettinen, Teemu P; Peltier, Julien; Härtlova, Anetta; Gierliński, Marek; Jansen, Valerie M; Trost, Matthias; Björklund, Mikael. Thermal proteome profiling of breast cancer cells reveals proteasomal activation by CDK4/6 inhibitor palbociclib. The Embo Journal. 2018;37(10) PubMed |
| Yang, Shyh-Ming; Martinez, Natalia J; Yasgar, Adam; Danchik, Carina; Johansson, Catrine; Wang, Yuhong; Baljinnyam, Bolormaa; Wang, Amy Q; Xu, Xin; Shah, Pranav; Cheff, Dorian; Wang, Xinran S; Roth, Jacob; Lal-Nag, Madhu; Dunford, James E; Oppermann, Udo; Vasiliou, Vasilis; Simeonov, Anton; Jadhav, Ajit; Maloney, David J. Discovery of Orally Bioavailable, Quinoline-Based Aldehyde Dehydrogenase 1A1 (ALDH1A1) Inhibitors with Potent Cellular Activity. Journal Of Medicinal Chemistry. 2018;61(11):4883-4903. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Pintado-Berninches, Laura; Fernandez-Varas, Beatriz; Benitez-Buelga, Carlos; Manguan-Garcia, Cristina; Serrano-Benitez, Almudena; Iarriccio, Laura; Carrillo, Jaime; Guenechea, Guillermo; Egusquiaguirre, Susana P; Pedraz, Jose-Luis; Hernández, Rosa M; Igartua, Manoli; Arias-Salgado, Elena G; Cortés-Ledesma, Felipe; Sastre, Leandro; Perona, Rosario. GSE4 peptide suppresses oxidative and telomere deficiencies in ataxia telangiectasia patient cells. Cell Death And Differentiation. 2019;26(10):1998-2014. PubMed |
| Treml, Jakub; Leláková, Veronika; Šmejkal, Karel; Paulíčková, Tereza; Labuda, Šimon; Granica, Sebastian; Havlík, Jaroslav; Jankovská, Dagmar; Padrtová, Tereza; Hošek, Jan. Antioxidant Activity of Selected Stilbenoid Derivatives in a Cellular Model System. Biomolecules. 2019;9(9) PubMed |
| Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |
| Langebäck, Anette; Bacanu, Smaranda; Laursen, Henriette; Mout, Lisanne; Seki, Takahiro; Erkens-Schulze, Sigrun; Ramos, Anderson Daniel; Berggren, Anna; Cao, Yihai; Hartman, Johan; van Weerden, Wytske; Bergh, Jonas; Nordlund, Pär; Lööf, Sara. CETSA-based target engagement of taxanes as biomarkers for efficacy and resistance. Scientific Reports. 2019;9(1):19384. PubMed |
| Treml, Jakub; Večeřová, Petra; Herczogová, Petra; Šmejkal, Karel. Direct and Indirect Antioxidant Effects of Selected Plant Phenolics in Cell-Based Assays. Molecules (Basel, Switzerland). 2021;26(9) PubMed |
| Bayer, David; Antonucci, Stefano; Müller, Hans-Peter; Saad, Rami; Dupuis, Luc; Rasche, Volker; Böckers, Tobias M; Ludolph, Albert C; Kassubek, Jan; Roselli, Francesco. Disruption of orbitofrontal-hypothalamic projections in a murine ALS model and in human patients. Translational Neurodegeneration. 2021;10(1):17. PubMed |
| De Lazzari, Federica; Agostini, Francesco; Doni, Davide; Malacrida, Sandro; Zordan, Mauro A; Costantini, Paola; Bubacco, Luigi; Sandrelli, Federica; Bisaglia, Marco. DJ-1 and SOD1 Act Independently in the Protection against Anoxia in Drosophila melanogaster. Antioxidants (Basel, Switzerland). 2022;11(8) PubMed |
| Yee, Yi Hui; Chong, Stephen Jun Fei; Kong, Li Ren; Goh, Boon Cher; Pervaiz, Shazib. Sustained IKKβ phosphorylation and NF-κB activation by superoxide-induced peroxynitrite-mediated nitrotyrosine modification of B56γ3 and PP2A inactivation. Redox Biology. 2021;41( 33838472):101834. PubMed |