Anti SNX4 pAb (ATL-HPA005709)

Atlas Antibodies

Catalog No.:
ATL-HPA005709-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sorting nexin 4
Gene Name: SNX4
Alternative Gene Name: ATG24B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022808: 98%, ENSRNOG00000001786: 99%
Entrez Gene ID: 8723
Uniprot ID: O95219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE
Gene Sequence LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE
Gene ID - Mouse ENSMUSG00000022808
Gene ID - Rat ENSRNOG00000001786
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX4 pAb (ATL-HPA005709)
Datasheet Anti SNX4 pAb (ATL-HPA005709) Datasheet (External Link)
Vendor Page Anti SNX4 pAb (ATL-HPA005709) at Atlas Antibodies

Documents & Links for Anti SNX4 pAb (ATL-HPA005709)
Datasheet Anti SNX4 pAb (ATL-HPA005709) Datasheet (External Link)
Vendor Page Anti SNX4 pAb (ATL-HPA005709)
Citations for Anti SNX4 pAb (ATL-HPA005709) – 1 Found
Steinberg, Florian; Gallon, Matthew; Winfield, Mark; Thomas, Elaine C; Bell, Amanda J; Heesom, Kate J; Tavaré, Jeremy M; Cullen, Peter J. A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport. Nature Cell Biology. 2013;15(5):461-71.  PubMed