Anti SNX4 pAb (ATL-HPA005709)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005709-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SNX4
Alternative Gene Name: ATG24B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022808: 98%, ENSRNOG00000001786: 99%
Entrez Gene ID: 8723
Uniprot ID: O95219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE |
| Gene Sequence | LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE |
| Gene ID - Mouse | ENSMUSG00000022808 |
| Gene ID - Rat | ENSRNOG00000001786 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNX4 pAb (ATL-HPA005709) | |
| Datasheet | Anti SNX4 pAb (ATL-HPA005709) Datasheet (External Link) |
| Vendor Page | Anti SNX4 pAb (ATL-HPA005709) at Atlas Antibodies |
| Documents & Links for Anti SNX4 pAb (ATL-HPA005709) | |
| Datasheet | Anti SNX4 pAb (ATL-HPA005709) Datasheet (External Link) |
| Vendor Page | Anti SNX4 pAb (ATL-HPA005709) |
| Citations for Anti SNX4 pAb (ATL-HPA005709) – 1 Found |
| Steinberg, Florian; Gallon, Matthew; Winfield, Mark; Thomas, Elaine C; Bell, Amanda J; Heesom, Kate J; Tavaré, Jeremy M; Cullen, Peter J. A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport. Nature Cell Biology. 2013;15(5):461-71. PubMed |