Anti SNX4 pAb (ATL-HPA005709)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005709-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: SNX4
Alternative Gene Name: ATG24B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022808: 98%, ENSRNOG00000001786: 99%
Entrez Gene ID: 8723
Uniprot ID: O95219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC | 
| Reactivity | Human, Mouse, Rat | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE | 
| Gene Sequence | LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE | 
| Gene ID - Mouse | ENSMUSG00000022808 | 
| Gene ID - Rat | ENSRNOG00000001786 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti SNX4 pAb (ATL-HPA005709) | |
| Datasheet | Anti SNX4 pAb (ATL-HPA005709) Datasheet (External Link) | 
| Vendor Page | Anti SNX4 pAb (ATL-HPA005709) at Atlas Antibodies | 
| Documents & Links for Anti SNX4 pAb (ATL-HPA005709) | |
| Datasheet | Anti SNX4 pAb (ATL-HPA005709) Datasheet (External Link) | 
| Vendor Page | Anti SNX4 pAb (ATL-HPA005709) | 
| Citations for Anti SNX4 pAb (ATL-HPA005709) – 1 Found | 
| Steinberg, Florian; Gallon, Matthew; Winfield, Mark; Thomas, Elaine C; Bell, Amanda J; Heesom, Kate J; Tavaré, Jeremy M; Cullen, Peter J. A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport. Nature Cell Biology. 2013;15(5):461-71. PubMed | 
 
         
                             
                                        ![Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/81541/148361/atl-hpa005709_anti-snx4-pab-atl-hpa005709_29985__18803.1681097478.jpg?c=2)