Anti SNX33 pAb (ATL-HPA040988)

Atlas Antibodies

Catalog No.:
ATL-HPA040988-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sorting nexin 33
Gene Name: SNX33
Alternative Gene Name: MGC32065, SH3PX3, SH3PXD3C, SNX30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032733: 98%, ENSRNOG00000017382: 98%
Entrez Gene ID: 257364
Uniprot ID: Q8WV41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
Gene Sequence VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
Gene ID - Mouse ENSMUSG00000032733
Gene ID - Rat ENSRNOG00000017382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX33 pAb (ATL-HPA040988)
Datasheet Anti SNX33 pAb (ATL-HPA040988) Datasheet (External Link)
Vendor Page Anti SNX33 pAb (ATL-HPA040988) at Atlas Antibodies

Documents & Links for Anti SNX33 pAb (ATL-HPA040988)
Datasheet Anti SNX33 pAb (ATL-HPA040988) Datasheet (External Link)
Vendor Page Anti SNX33 pAb (ATL-HPA040988)