Anti SNX33 pAb (ATL-HPA040988)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040988-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SNX33
Alternative Gene Name: MGC32065, SH3PX3, SH3PXD3C, SNX30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032733: 98%, ENSRNOG00000017382: 98%
Entrez Gene ID: 257364
Uniprot ID: Q8WV41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK |
Gene Sequence | VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK |
Gene ID - Mouse | ENSMUSG00000032733 |
Gene ID - Rat | ENSRNOG00000017382 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX33 pAb (ATL-HPA040988) | |
Datasheet | Anti SNX33 pAb (ATL-HPA040988) Datasheet (External Link) |
Vendor Page | Anti SNX33 pAb (ATL-HPA040988) at Atlas Antibodies |
Documents & Links for Anti SNX33 pAb (ATL-HPA040988) | |
Datasheet | Anti SNX33 pAb (ATL-HPA040988) Datasheet (External Link) |
Vendor Page | Anti SNX33 pAb (ATL-HPA040988) |