Anti SNX33 pAb (ATL-HPA040988)

Atlas Antibodies

Catalog No.: ATL-HPA040988-25

Protein Description: sorting nexin 33
Gene Name: SNX33
Alternative Gene Name: MGC32065, SH3PX3, SH3PXD3C, SNX30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032733: 98%, ENSRNOG00000017382: 98%
Entrez Gene ID: 257364
Uniprot ID: Q8WV41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
• Gene Sequence: VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
• Gene ID - Mouse: ENSMUSG00000032733
• Gene ID - Rat: ENSRNOG00000017382
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.