Anti SNX33 pAb (ATL-HPA040988)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040988-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SNX33
Alternative Gene Name: MGC32065, SH3PX3, SH3PXD3C, SNX30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032733: 98%, ENSRNOG00000017382: 98%
Entrez Gene ID: 257364
Uniprot ID: Q8WV41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK |
| Gene Sequence | VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK |
| Gene ID - Mouse | ENSMUSG00000032733 |
| Gene ID - Rat | ENSRNOG00000017382 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNX33 pAb (ATL-HPA040988) | |
| Datasheet | Anti SNX33 pAb (ATL-HPA040988) Datasheet (External Link) |
| Vendor Page | Anti SNX33 pAb (ATL-HPA040988) at Atlas Antibodies |
| Documents & Links for Anti SNX33 pAb (ATL-HPA040988) | |
| Datasheet | Anti SNX33 pAb (ATL-HPA040988) Datasheet (External Link) |
| Vendor Page | Anti SNX33 pAb (ATL-HPA040988) |