Anti SNX30 pAb (ATL-HPA019346)

Atlas Antibodies

Catalog No.: ATL-HPA019346-25

Protein Description: sorting nexin family member 30
Gene Name: SNX30
Alternative Gene Name: ATG24A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028385: 96%, ENSRNOG00000017132: 99%
Entrez Gene ID: 401548
Uniprot ID: Q5VWJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETY
• Gene Sequence: VGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETY
• Gene ID - Mouse: ENSMUSG00000028385
• Gene ID - Rat: ENSRNOG00000017132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.