Anti SNX30 pAb (ATL-HPA019346)

Atlas Antibodies

Catalog No.:
ATL-HPA019346-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sorting nexin family member 30
Gene Name: SNX30
Alternative Gene Name: ATG24A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028385: 96%, ENSRNOG00000017132: 99%
Entrez Gene ID: 401548
Uniprot ID: Q5VWJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETY
Gene Sequence VGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETY
Gene ID - Mouse ENSMUSG00000028385
Gene ID - Rat ENSRNOG00000017132
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX30 pAb (ATL-HPA019346)
Datasheet Anti SNX30 pAb (ATL-HPA019346) Datasheet (External Link)
Vendor Page Anti SNX30 pAb (ATL-HPA019346) at Atlas Antibodies

Documents & Links for Anti SNX30 pAb (ATL-HPA019346)
Datasheet Anti SNX30 pAb (ATL-HPA019346) Datasheet (External Link)
Vendor Page Anti SNX30 pAb (ATL-HPA019346)