Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062810-25
  • Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
  • Western blot analysis in human cell line MCF-7 and human cell line CACO-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sorting nexin 29
Gene Name: SNX29
Alternative Gene Name: FLJ12363, RUNDC2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071669: 86%, ENSRNOG00000002294: 86%
Entrez Gene ID: 92017
Uniprot ID: Q8TEQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRNLLDGEMEHSAALRQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWSVDGEVTVA
Gene Sequence LRNLLDGEMEHSAALRQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWSVDGEVTVA
Gene ID - Mouse ENSMUSG00000071669
Gene ID - Rat ENSRNOG00000002294
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation)
Datasheet Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation)
Datasheet Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation)