Anti SNX21 pAb (ATL-HPA046359)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046359-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SNX21
Alternative Gene Name: C20orf161, dJ337O18.4, SNX-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050373: 95%, ENSRNOG00000053247: 95%
Entrez Gene ID: 90203
Uniprot ID: Q969T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA |
Gene Sequence | RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA |
Gene ID - Mouse | ENSMUSG00000050373 |
Gene ID - Rat | ENSRNOG00000053247 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX21 pAb (ATL-HPA046359) | |
Datasheet | Anti SNX21 pAb (ATL-HPA046359) Datasheet (External Link) |
Vendor Page | Anti SNX21 pAb (ATL-HPA046359) at Atlas Antibodies |
Documents & Links for Anti SNX21 pAb (ATL-HPA046359) | |
Datasheet | Anti SNX21 pAb (ATL-HPA046359) Datasheet (External Link) |
Vendor Page | Anti SNX21 pAb (ATL-HPA046359) |