Anti SNX21 pAb (ATL-HPA046359)

Atlas Antibodies

Catalog No.:
ATL-HPA046359-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sorting nexin family member 21
Gene Name: SNX21
Alternative Gene Name: C20orf161, dJ337O18.4, SNX-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050373: 95%, ENSRNOG00000053247: 95%
Entrez Gene ID: 90203
Uniprot ID: Q969T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA
Gene Sequence RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA
Gene ID - Mouse ENSMUSG00000050373
Gene ID - Rat ENSRNOG00000053247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX21 pAb (ATL-HPA046359)
Datasheet Anti SNX21 pAb (ATL-HPA046359) Datasheet (External Link)
Vendor Page Anti SNX21 pAb (ATL-HPA046359) at Atlas Antibodies

Documents & Links for Anti SNX21 pAb (ATL-HPA046359)
Datasheet Anti SNX21 pAb (ATL-HPA046359) Datasheet (External Link)
Vendor Page Anti SNX21 pAb (ATL-HPA046359)