Anti SNX21 pAb (ATL-HPA046359)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046359-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SNX21
Alternative Gene Name: C20orf161, dJ337O18.4, SNX-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050373: 95%, ENSRNOG00000053247: 95%
Entrez Gene ID: 90203
Uniprot ID: Q969T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA |
| Gene Sequence | RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA |
| Gene ID - Mouse | ENSMUSG00000050373 |
| Gene ID - Rat | ENSRNOG00000053247 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNX21 pAb (ATL-HPA046359) | |
| Datasheet | Anti SNX21 pAb (ATL-HPA046359) Datasheet (External Link) |
| Vendor Page | Anti SNX21 pAb (ATL-HPA046359) at Atlas Antibodies |
| Documents & Links for Anti SNX21 pAb (ATL-HPA046359) | |
| Datasheet | Anti SNX21 pAb (ATL-HPA046359) Datasheet (External Link) |
| Vendor Page | Anti SNX21 pAb (ATL-HPA046359) |